Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-ymc0

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). Uncharacterized protein YML020W

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: Z46659, AY692729, BK006946
1 UniProt : Q03722
3 UniProt : Q03722, D6VZF4, Q6B2K1
3 Interpro : Q03722, D6VZF4, Q6B2K1
3 Pfam : Q03722, D6VZF4, Q6B2K1
3 PIRSF : Q03722, D6VZF4, Q6B2K1
3 SUPERFAM : Q03722, D6VZF4, Q6B2K1
Sequence
Graphical view for this peptide sequence: yeast-ymc0
Colored MSA for 6_AlphaBeta_hydrolase (raw)
REGEIFDRVDFFYEVMKHWSKEINNSDFIYFVSHSQGCPVTIMLLAKLIK
NGIINLDNSQFFNDEIQFCSSKKIISVLAMAGINNGPFYGADQTLFVRAY
QTIEKDSLRELFEFQKFDSKQSQSFIEGLRTIISNNVKITFVGSINDQLV
PLYSSTCLFANHPNIFRAIFIDRGSQTPAF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

REGEIFDRVDFFYEVMKHWSKEINNSDFIYFVSHSQGCPVTIMLLAKLIK
NGIINLDNSQFFNDEIQFCSSKKIISVLAMAGINNGPFYGADQTLFVRAY
QTIEKDSLRELFEFQKFDSKQSQSFIEGLRTIISNNVKITFVGSINDQLV
PLYSSTCLFANHPNIFRAIFIDRGSQTPAF


References
1 more
    Title: The reference genome sequence of Saccharomyces cerevisiae: then and now
    Engel SR, Dietrich FS, Fisk DG, Binkley G, Balakrishnan R, Costanzo MC, Dwight SS, Hitz BC, Karra K and Cherry JM <7 more author(s)>
    Ref: G3 (Bethesda), 4:389, 2014 : PubMed

            

    Title: Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae
    Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S and LaBaer J <14 more author(s)>
    Ref: Genome Res, 17:536, 2007 : PubMed

            

    Title: The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII
    Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S and Barrell B <12 more author(s)>
    Ref: Nature, 387:90, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer