9ceta-s9yb99

Camelus ferus (Wild Bactrian camel) Carboxylesterase 7

Comment

"an insertion 396 PALWKAGAWAIRETSFPFDDMMCSRRTPRFFPQ"

Relationship

Family : Carb_B_Chordata

Block : C

Position in NCBI Life Tree : Camelus ferus

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSGEWVQPGQTLIWAFWVLAATAEGPAADAPVRNTRLGWV
RGKQATVLGN DMPVNVFLGIPYAAPPVGPLRFAKPKPAS
PWNDFQDATSYPNLCLQNSEW LFSDQHILKVHYPTFRVS
EDCLYLNIYAPAHADAGSKLPVMVWLPGGAFE TGSASIF
DGSALAAYEDVLVVTIQYRLGMFGFFNTGDKHALGNWAFM
DQV AALTWVQENIEFFGGDPHCVTIFGESAGAISVSSLI
LSPMAKGLFHKAIM ESGVAIMPYLKAPNDERNEDMVANI
CGCNASDSVALLQCLRAKSSKELLS INQRAKSFTRVVDG
FFFPREPVDLLTQKSFKPVPSIIGVNNHECGFLLPM KEF
PEILEGSNKSLALHLIHSILHIPIQYLYLVGNEYFYNKHS
LVDIRNS FLDLLGDVFFVIPGLVTAKCHRDAGAPVYFYE
FQHRPQCLKDKKPAFVKA DHTDEIRFVFGGAFLKGDIVM
FEGATEEEQWLSRKMMRYWANFARTG

References