Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: plaba-q4z5z8

Plasmodium berghei phosphatidylcholine-sterol acyltransferase, putative

Comment
Other strains: Plasmodium berghei (strain Anka)


Relationship
Family|PC-sterol_acyltransferase
Block| L
Position in NCBI Life Tree|Plasmodium berghei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Alveolata: N E > Apicomplexa: N E > Aconoidasida: N E > Haemosporida: N E > Plasmodiidae: N E > Plasmodium: N E > Plasmodium (Vinckeia): N E > Plasmodium berghei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: plaba-q4z5z8
Colored MSA for PC-sterol_acyltransferase (raw)
MEIVGSSKRSNSAISDKKIKNSVYLIPGLGGSTLIAEYNDADIESCSSKL
LHSKPYRIWLSISRFSIRSNVYCLFDTLKLDYDRENKIYRNKPGVIINVE
NYGYIKGVAFLDYVKNKPLRLTRYYGILADKFLENEYIDGKDILSAPYDW
RFPLSQQKYNVLKSHIEHIYKIKQEIKVNLIGHSLGGLFINYFLSQFVDE
EWKKKHINIVIHINVPFAGSIKAIRALLYNNKDYTLFKLKNILKVSISGS
LMRAISHNMGSPLDLLPYRKYYDRDQIVVIINMDEFPIDEKLAQSIVTEC
GIYNESCYTDREDVNLKTYTLSNWYELLSNDMREKYENYIQYTDRFFSVD
HGIPTYCLYSTTKKKNTEYMLFYQDTHFIQDPIIYYGIGDGTIPLESLEA
CKKLQNVKEAKHFEYYKHIGILKNDIVSDYIYNIIDKNTTN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEIVGSSKRSNSAISDKKIKNSVYLIPGLGGSTLIAEYNDADIESCSSKL
LHSKPYRIWLSISRFSIRSNVYCLFDTLKLDYDRENKIYRNKPGVIINVE
NYGYIKGVAFLDYVKNKPLRLTRYYGILADKFLENEYIDGKDILSAPYDW
RFPLSQQKYNVLKSHIEHIYKIKQEIKVNLIGHSLGGLFINYFLSQFVDE
EWKKKHINIVIHINVPFAGSIKAIRALLYNNKDYTLFKLKNILKVSISGS
LMRAISHNMGSPLDLLPYRKYYDRDQIVVIINMDEFPIDEKLAQSIVTEC
GIYNESCYTDREDVNLKTYTLSNWYELLSNDMREKYENYIQYTDRFFSVD
HGIPTYCLYSTTKKKNTEYMLFYQDTHFIQDPIIYYGIGDGTIPLESLEA
CKKLQNVKEAKHFEYYKHIGILKNDIVSDYIYNIIDKNTTN


References
    Title: A Plasmodium phospholipase is involved in disruption of the liver stage parasitophorous vacuole membrane
    Burda PC, Roelli MA, Schaffner M, Khan SM, Janse CJ, Heussler VT
    Ref: PLoS Pathog, 11:e1004760, 2015 : PubMed

            

    Title: A comprehensive survey of the Plasmodium life cycle by genomic, transcriptomic, and proteomic analyses
    Hall N, Karras M, Raine JD, Carlton JM, Kooij TW, Berriman M, Florens L, Janssen CS, Pain A and Sinden RE <20 more author(s)>
    Ref: Science, 307:82, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer