Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: plach-q4xmy0

Plasmodium chabaudi Phospholipase, putative

Relationship
Family|Plasmodium_subtelomeric_PST-A
Block| X
Position in NCBI Life Tree|Plasmodium chabaudi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Alveolata: N E > Apicomplexa: N E > Aconoidasida: N E > Haemosporida: N E > Plasmodiidae: N E > Plasmodium: N E > Plasmodium (Vinckeia): N E > Plasmodium chabaudi: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CAAJ01004553
Sequence
Graphical view for this peptide sequence: plach-q4xmy0
Colored MSA for Plasmodium_subtelomeric_PST-A (raw)
MDNFRFKNLFRNAKYKLAGKPKEGWLFNKNGLLLKTYRWLVNNPIGIVLL
IHGFQGNTQLTFMKEAVQTVYSNKGMKFYDKGFTYKGSWIEKFNQNNYSV
YGIDLQGHGGSQSPGKIRGSVNCFNDLVDDVIQYMNEIQDDISNENQTDD
ESHDIVPTKKKRLPMYVIGHSMGGNIALRILQLLGKEKEDRIKAKDSKTI
CYNCLDNLNIKGCVSLAGMIRINIPFDSGNKSFNDFYLPIINYASQIAPD
ARLLVNFRRHNPPTYSVNIHNNNNGLELKCVYELIKATVTLDSDINYMPK
DIPFLI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDNFRFKNLFRNAKYKLAGKPKEGWLFNKNGLLLKTYRWLVNNPIGIVLL
IHGFQGNTQLTFMKEAVQTVYSNKGMKFYDKGFTYKGSWIEKFNQNNYSV
YGIDLQGHGGSQSPGKIRGSVNCFNDLVDDVIQYMNEIQDDISNENQTDD
ESHDIVPTKKKRLPMYVIGHSMGGNIALRILQLLGKEKEDRIKAKDSKTI
CYNCLDNLNIKGCVSLAGMIRINIPFDSGNKSFNDFYLPIINYASQIAPD
ARLLVNFRRHNPPTYSVNIHNNNNGLELKCVYELIKATVTLDSDINYMPK
DIPFLI


Reference
    Title: A comprehensive survey of the Plasmodium life cycle by genomic, transcriptomic, and proteomic analyses
    Hall N, Karras M, Raine JD, Carlton JM, Kooij TW, Berriman M, Florens L, Janssen CS, Pain A and Sinden RE <20 more author(s)>
    Ref: Science, 307:82, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer