arath-SCP23

Arabidopsis thaliana (Mouse-ear cress) T29E15.21, SCPL23, At2g24010 putative serine carboxypeptidase

Comment

Relationship

Family : Carboxypeptidase_S10

Block : X

Position in NCBI Life Tree : Arabidopsis thaliana

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MIKALPGQPQVGFSQFSGYVTVNESHGRSLFYWLTESPSS
SHTKPLLLWL NGGPGCSSIGYGASEEIGPFRINKTGSNL
YLNKFTWNTEANILFLESPAG VGFSYTNTSSDLKDSGDE
RTAQENLIFLIKWMSRFPQYQYRDFYIVGESY AGHYVPQ
LAKKIHLYNKAFNNTPIINLKGFMVGNGDMDKHYDRLGAA
MYA WSHAMISDKTYKSILKHCSFTADKTSDKCNWALYFA
YREFGKVNGYSIYS PSCVHQTNQTKFLHGRLLVEEYEYD
PCTESYAEIYYNRPDVQRAMHANLT SIPYKWTLCNMVVN
NNWKDSEFSMLPIYKELTAAGLRIWVFSGDTDAVVP VTG
TRLALSKLNLPVKTPWYPWYSEKQVGGWTEVYEGLTFATI
RGAGHEV PVLQPERALTLLRSFLAGKELPRSY

References

Title : An expression and bioinformatics analysis of the Arabidopsis serine carboxypeptidase-like gene family - Fraser_2005_Plant.Physiol_138_1136
Author(s) : Fraser CM , Rider LW , Chapple C
Ref : Plant Physiol , 138 :1136 , 2005
Abstract : Fraser_2005_Plant.Physiol_138_1136
ESTHER : Fraser_2005_Plant.Physiol_138_1136
PubMedSearch : Fraser_2005_Plant.Physiol_138_1136
PubMedID: 15908604
Gene_locus related to this paper: arath-AT4g30610 , arath-SCP25 , arath-SCP27 , arath-SCP16 , arath-SCP4 , arath-SCP7 , arath-SCP8 , arath-SCP11 , arath-SCP15 , arath-SCP18 , arath-SCP23 , arath-SCP26 , arath-SCP28 , arath-SCP32 , arath-SCP33 , arath-SCP36 , arath-SCP40 , arath-SCP44 , arath-SCPL6 , arath-SCPL34 , arath-SCP22

Title : Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana - Lin_1999_Nature_402_761
Author(s) : Lin X , Kaul S , Rounsley S , Shea TP , Benito MI , Town CD , Fujii CY , Mason T , Bowman CL , Barnstead M , Feldblyum TV , Buell CR , Ketchum KA , Lee J , Ronning CM , Koo HL , Moffat KS , Cronin LA , Shen M , Pai G , Van Aken S , Umayam L , Tallon LJ , Gill JE , Adams MD , Carrera AJ , Creasy TH , Goodman HM , Somerville CR , Copenhaver GP , Preuss D , Nierman WC , White O , Eisen JA , Salzberg SL , Fraser CM , Venter JC
Ref : Nature , 402 :761 , 1999
Abstract : Lin_1999_Nature_402_761
ESTHER : Lin_1999_Nature_402_761
PubMedSearch : Lin_1999_Nature_402_761
PubMedID: 10617197
Gene_locus related to this paper: arath-At2g45610 , arath-AT2G03550 , arath-AT2G05260 , arath-AT2G12480 , arath-At2g15230 , arath-At2g18360 , arath-At2g19550 , arath-At2g19620 , arath-At2g24280 , arath-AT2G24320 , arath-At2g26740 , arath-At2g26750 , arath-SCP51 , arath-AT2G36290 , arath-At2g42450 , arath-AT2G42690 , arath-AT2G44970 , arath-At2g47630 , arath-AT3g62590 , arath-CGEP , arath-F12L6.6 , arath-F12L6.7 , arath-F12L6.8 , arath-At3g50790 , arath-MES6 , arath-MES7 , arath-MES4 , arath-MES8 , arath-MES2 , arath-MES3 , arath-MES1 , arath-o80731 , arath-pip , arath-PLA11 , arath-PLA13 , arath-PLA16 , arath-PLA19 , arath-q84w08 , arath-SCP8 , arath-SCP9 , arath-SCP10 , arath-SCP11 , arath-SCP12 , arath-SCP13 , arath-SCP23 , arath-SCP26 , arath-SCP28 , arath-SCP46 , arath-T26B15.8 , arath-SCP22 , arath-SFGH , arath-MES19