arath-AT4g30610

Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) putative serine carboxypeptidase II protein AT4g30610 SCP24

Comment

Relationship

Family : Carboxypeptidase_S10

Block : X

Position in NCBI Life Tree : Arabidopsis thaliana

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MARTHFIFLLLVALLSTTFPSSSSSREQEKDRIKALPGQP
KVAFSQYSGY VNVNQSHGRALFYWLTESSSPSPHTKPLL
LWLNGGPGCSSIAYGASEEIG PFRINKNGSNLYLNKFAW
NKDANLLFLESPAGVGYSYTNTSSDLKDSGDE RTAQDNL
IFLIKWLSRFPQYKYRDFYIAGESYAGHYVPQLAKKINDY
NKA FSKPIINLKGFLVGNAVTDNQYDSIGTVTYWWTHAI
ISDKSYKSILKYCN FTVERVSDDCDNAVNYAMNHEFGDI
DQYSIYTPTCVAAQQKKNTTGFFVR MKNTLLRRRLVSGY
DPCTESYAEKYFNRPDVQRAMHANVTGIRYKWTACS DVL
IKTWKDSDKTMLPIYKELAASGLRIWIFSGDTDSVVPVTA
TRFSLSH LNLPVKTRWYPWYTDNQVGGWTEVYKGLTFAT
VRGAGHEVPLFEPKRALI LFRSFLAGKELPRSY

References

Title : The Arabidopsis lyrata genome sequence and the basis of rapid genome size change - Hu_2011_Nat.Genet_43_476
Author(s) : Hu TT , Pattyn P , Bakker EG , Cao J , Cheng JF , Clark RM , Fahlgren N , Fawcett JA , Grimwood J , Gundlach H , Haberer G , Hollister JD , Ossowski S , Ottilar RP , Salamov AA , Schneeberger K , Spannagl M , Wang X , Yang L , Nasrallah ME , Bergelson J , Carrington JC , Gaut BS , Schmutz J , Mayer KF , Van de Peer Y , Grigoriev IV , Nordborg M , Weigel D , Guo YL
Ref : Nat Genet , 43 :476 , 2011
Abstract : Hu_2011_Nat.Genet_43_476
ESTHER : Hu_2011_Nat.Genet_43_476
PubMedSearch : Hu_2011_Nat.Genet_43_476
PubMedID: 21478890
Gene_locus related to this paper: arall-d7kc59 , arall-d7kfz1 , arall-d7kjk9 , arall-d7kk58 , arall-d7kuj1 , arall-d7kwx5 , arall-d7kzq8 , arall-d7laf7 , arall-D7LAK6 , arall-d7ltj2 , arall-d7lu11 , arall-d7ly06 , arall-d7lyn6 , arall-d7m1k0 , arall-d7m1k1 , arall-d7m1k3 , arall-d7m1l4 , arall-d7m814 , arall-d7mbk0 , arall-d7mbn8 , arall-d7mgs1 , arall-d7mi04 , arall-d7mld7 , arall-d7mpg7 , arall-d7mul9 , arath-At2g45610 , arath-At1g05790 , arath-At1g09980 , arath-At1g18360 , arath-AT1G29120 , arath-AT1G73920 , arath-AT1G76140 , arath-AT2G05260 , arath-At2g15230 , arath-At2g24280 , arath-AT2G42690 , arath-At2g47630 , arath-AT3G12150 , arath-At3g61680 , arath-AT3g62590 , arath-AT4G00500 , arath-AT4G25770 , arath-AT4g30610 , arath-At5g11650 , arath-At5g13640 , arath-AT5G19050 , arath-AT5G20060 , arath-AT5G20520 , arath-AT5G27320 , arath-At5g42930 , arath-At5g47330 , arath-CGEP , arath-clh1 , arath-clh2 , arath-F1N13.220 , arath-F2G14.100 , arath-F12A4.4 , arath-F14O10.2 , arath-SCP27 , arath-HNL , arath-GID1B , arath-LIP2 , arath-At5g17670 , arath-pip , arath-PLA11 , arath-PLA12 , arath-PLA13 , arath-PLA15 , arath-PLA17 , arath-Q8LPF5 , arath-Q9FFZ1 , arath-Q9FJ29 , arath-Q9FKP9 , arath-Q9FNF6 , arath-q9lhe8 , arath-Q9SFF6 , arath-q84w08 , arath-SCP7 , arath-SCP8 , arath-SCP26 , arath-SCP28 , arath-SCP33 , arath-SCP40 , arath-SCPL34 , arath-At4g12230 , arath-MES14 , arath-T19F11.2 , arath-MES10 , arath-At5g11790 , arath-T26B15.8 , arath-ZW18 , arall-d7l971 , arall-d7lfd3 , arall-d7lg04 , arall-d7lg05 , arall-d7lg06 , arall-d7lg07 , arall-d7mb17 , arall-d7mb18 , arall-d7l7v2 , arall-d7l7v3 , arall-d7lst0 , arall-d7lfw9 , arall-d7mgs6 , arall-d7mur3 , arall-d7kjr5 , arall-d7l7v1 , arall-d7ls88 , arall-d7kzg6 , arall-d7kcm6 , arall-d7krm0 , arall-d7kwe4 , arall-d7lri7 , arall-d7kq26

Title : Arabidopsis BRS1 is a secreted and active serine carboxypeptidase - Zhou_2005_J.Biol.Chem_280_35554
Author(s) : Zhou A , Li J
Ref : Journal of Biological Chemistry , 280 :35554 , 2005
Abstract : Zhou_2005_J.Biol.Chem_280_35554
ESTHER : Zhou_2005_J.Biol.Chem_280_35554
PubMedSearch : Zhou_2005_J.Biol.Chem_280_35554
PubMedID: 16123046
Gene_locus related to this paper: arath-AT4g30610

Title : An expression and bioinformatics analysis of the Arabidopsis serine carboxypeptidase-like gene family - Fraser_2005_Plant.Physiol_138_1136
Author(s) : Fraser CM , Rider LW , Chapple C
Ref : Plant Physiol , 138 :1136 , 2005
Abstract : Fraser_2005_Plant.Physiol_138_1136
ESTHER : Fraser_2005_Plant.Physiol_138_1136
PubMedSearch : Fraser_2005_Plant.Physiol_138_1136
PubMedID: 15908604
Gene_locus related to this paper: arath-AT4g30610 , arath-SCP25 , arath-SCP27 , arath-SCP16 , arath-SCP4 , arath-SCP7 , arath-SCP8 , arath-SCP11 , arath-SCP15 , arath-SCP18 , arath-SCP23 , arath-SCP26 , arath-SCP28 , arath-SCP32 , arath-SCP33 , arath-SCP36 , arath-SCP40 , arath-SCP44 , arath-SCPL6 , arath-SCPL34 , arath-SCP22

Title : BRS1, a serine carboxypeptidase, regulates BRI1 signaling in Arabidopsis thaliana - Li_2001_Proc.Natl.Acad.Sci.U.S.A_98_5916
Author(s) : Li J , Lease KA , Tax FE , Walker JC
Ref : Proc Natl Acad Sci U S A , 98 :5916 , 2001
Abstract : Li_2001_Proc.Natl.Acad.Sci.U.S.A_98_5916
ESTHER : Li_2001_Proc.Natl.Acad.Sci.U.S.A_98_5916
PubMedSearch : Li_2001_Proc.Natl.Acad.Sci.U.S.A_98_5916
PubMedID: 11320207
Gene_locus related to this paper: arath-AT4g30610

Title : Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana - Mayer_1999_Nature_402_769
Author(s) : Mayer K , Schuller C , Wambutt R , Murphy G , Volckaert G , Pohl T , Dusterhoft A , Stiekema W , Entian KD , Terryn N , Harris B , Ansorge W , Brandt P , Grivell L , Rieger M , Weichselgartner M , de Simone V , Obermaier B , Mache R , Muller M , Kreis M , Delseny M , Puigdomenech P , Watson M , Schmidtheini T , Reichert B , Portatelle D , Perez-Alonso M , Boutry M , Bancroft I , Vos P , Hoheisel J , Zimmermann W , Wedler H , Ridley P , Langham SA , McCullagh B , Bilham L , Robben J , Van der Schueren J , Grymonprez B , Chuang YJ , Vandenbussche F , Braeken M , Weltjens I , Voet M , Bastiaens I , Aert R , Defoor E , Weitzenegger T , Bothe G , Ramsperger U , Hilbert H , Braun M , Holzer E , Brandt A , Peters S , van Staveren M , Dirske W , Mooijman P , Klein Lankhorst R , Rose M , Hauf J , Kotter P , Berneiser S , Hempel S , Feldpausch M , Lamberth S , Van den Daele H , De Keyser A , Buysshaert C , Gielen J , Villarroel R , De Clercq R , van Montagu M , Rogers J , Cronin A , Quail M , Bray-Allen S , Clark L , Doggett J , Hall S , Kay M , Lennard N , McLay K , Mayes R , Pettett A , Rajandream MA , Lyne M , Benes V , Rechmann S , Borkova D , Blocker H , Scharfe M , Grimm M , Lohnert TH , Dose S , de Haan M , Maarse A , Schafer M , Muller-Auer S , Gabel C , Fuchs M , Fartmann B , Granderath K , Dauner D , Herzl A , Neumann S , Argiriou A , Vitale D , Liguori R , Piravandi E , Massenet O , Quigley F , Clabauld G , Mundlein A , Felber R , Schnabl S , Hiller R , Schmidt W , Lecharny A , Aubourg S , Chefdor F , Cooke R , Berger C , Montfort A , Casacuberta E , Gibbons T , Weber N , Vandenbol M , Bargues M , Terol J , Torres A , Perez-Perez A , Purnelle B , Bent E , Johnson S , Tacon D , Jesse T , Heijnen L , Schwarz S , Scholler P , Heber S , Francs P , Bielke C , Frishman D , Haase D , Lemcke K , Mewes HW , Stocker S , Zaccaria P , Bevan M , Wilson RK , de la Bastide M , Habermann K , Parnell L , Dedhia N , Gnoj L , Schutz K , Huang E , Spiegel L , Sehkon M , Murray J , Sheet P , Cordes M , Abu-Threideh J , Stoneking T , Kalicki J , Graves T , Harmon G , Edwards J , Latreille P , Courtney L , Cloud J , Abbott A , Scott K , Johnson D , Minx P , Bentley D , Fulton B , Miller N , Greco T , Kemp K , Kramer J , Fulton L , Mardis E , Dante M , Pepin K , Hillier L , Nelson J , Spieth J , Ryan E , Andrews S , Geisel C , Layman D , Du H , Ali J , Berghoff A , Jones K , Drone K , Cotton M , Joshu C , Antonoiu B , Zidanic M , Strong C , Sun H , Lamar B , Yordan C , Ma P , Zhong J , Preston R , Vil D , Shekher M , Matero A , Shah R , Swaby IK , O'Shaughnessy A , Rodriguez M , Hoffmann J , Till S , Granat S , Shohdy N , Hasegawa A , Hameed A , Lodhi M , Johnson A , Chen E , Marra M , Martienssen R , McCombie WR
Ref : Nature , 402 :769 , 1999
Abstract : Mayer_1999_Nature_402_769
ESTHER : Mayer_1999_Nature_402_769
PubMedSearch : Mayer_1999_Nature_402_769
PubMedID: 10617198
Gene_locus related to this paper: arath-AT4G00500 , arath-AT4G16690 , arath-AT4G17480 , arath-AT4G24380 , arath-AT4g30610 , arath-o65513 , arath-o65713 , arath-LPAAT , arath-f4jt64

Title : Analysis of 1.9 Mb of contiguous sequence from chromosome 4 of Arabidopsis thaliana. - Bevan_1998_Nature_391_485
Author(s) : Bevan M , Bancroft I , Bent E , Love K , Goodman H , Dean C , Bergkamp R , Dirkse W , van Staveren M , Stiekema W , Drost L , Ridley P , Hudson SA , Patel K , Murphy G , Piffanelli P , Wedler H , Wedler E , Wambutt R , Weitzenegger T , Pohl TM , Terryn N , Gielen J , Villarroel R , De Clerck R , van Montagu M , Lecharny A , Auborg S , Gy I , Kreis M , Lao N , Kavanagh T , Hempel S , Kotter P , Entian KD , Rieger M , Schaeffer M , Funk B , Mueller-Auer S , Silvey M , James R , Montfort A , Pons A , Puigdomenech P , Douka A , Voukelatou E , Milioni D , Hatzopoulos P , Piravandi E , Obermaier B , Hilbert H , Duesterhoft A , Moores T , Jones JDG , Eneva T , Palme K , Benes V , Rechman S , Ansorge W , Cooke R , Berger C , Delseny M , Voet M , Volckaert G , Mewes HW , Klosterman S , Schueller C , Chalwatzis N
Ref : Nature , 391 :485 , 1998
Abstract : Bevan_1998_Nature_391_485
ESTHER : Bevan_1998_Nature_391_485
PubMedSearch : Bevan_1998_Nature_391_485
PubMedID: 9461215
Gene_locus related to this paper: arath-a4vcl8 , arath-AT4G00500 , arath-AT4g09900 , arath-AT4g12830 , arath-AT4G14290 , arath-AT4G15100 , arath-AT4G16070 , arath-AT4G16690 , arath-AT4G17150 , arath-AT4G17470 , arath-AT4G17480 , arath-AT4G17483 , arath-At4g18550 , arath-SOBR1 , arath-SOBRL , arath-AT4G24380 , arath-AT4G25770 , arath-AT4g30610 , arath-AT4G31020 , arath-AT4G36195 , arath-AT4G37150 , arath-SCP29 , arath-At3g54240 , arath-KAI2.D14L