bacld-q65fc5

Bacillus licheniformis (strain DSM 13 / ATCC 14580) putative acylaminoacyl-peptidase yuxl

Comment

"only c-term Pfam A Peptidase_S9 442 653"

Relationship

Family : ACPH_Peptidase_S9

Block : X

Position in NCBI Life Tree : Bacillus licheniformis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

EKAERLTDANQAFTEEHIISEPEELQFQAADGLTIHGWLI
KPAQYEKGNT YPLILEVHGGPHAMYANAYFHEFQVLAAK
GSAVVYVNPRGSHGYGQDFVN RVRGDYGGGDFKDVMAAV
DHVLEHYDFVDQERLGITGGSYGGFMTNWAVG HTKRFKA
AVTQRSISNWISFYGVSDIGYFFTDWQLGADLFEDPGKLW
EHS PLKYADKVETPLLILHGERDDRCPIEQAEQLFTALK
KMGKEVKLVRFPNA SHDLSRSGHPKQRIRRLEYIAGWFE
AYL

References

Title : Complete genome sequence of the industrial bacterium Bacillus licheniformis and comparisons with closely related Bacillus species - Rey_2004_Genome.Biol_5_R77
Author(s) : Rey MW , Ramaiya P , Nelson BA , Brody-Karpin SD , Zaretsky EJ , Tang M , Lopez de Leon A , Xiang H , Gusti V , Clausen IG , Olsen PB , Rasmussen MD , Andersen JT , Jorgensen PL , Larsen TS , Sorokin A , Bolotin A , Lapidus A , Galleron N , Ehrlich SD , Berka RM
Ref : Genome Biol , 5 :R77 , 2004
Abstract : Rey_2004_Genome.Biol_5_R77
ESTHER : Rey_2004_Genome.Biol_5_R77
PubMedSearch : Rey_2004_Genome.Biol_5_R77
PubMedID: 15461803
Gene_locus related to this paper: bacld-q62u01 , bacld-Q65L73 , bacld-q62yz9 , bacld-q65dz7 , bacld-q65e02 , bacld-q65eq1 , bacld-q65fc5 , bacld-q65fg2 , bacld-q65fg3 , bacld-q65fk9 , bacld-q65ft3 , bacld-q65fw3 , bacld-q65fy2 , bacld-q65gx2 , bacld-q65hn8 , bacld-q65hr4 , bacld-q65if8 , bacld-q65iy4 , bacld-q65j72 , bacld-q65le0 , bacld-q65ly2 , bacld-q65m29 , bacld-q65mg8 , bacld-q65my7 , bacld-q65n63 , bacld-q65nk2 , bacld-q65nm7 , bacli-LICC

Title : The complete genome sequence of Bacillus licheniformis DSM13, an organism with great industrial potential - Veith_2004_J.Mol.Microbiol.Biotechnol_7_204
Author(s) : Veith B , Herzberg C , Steckel S , Feesche J , Maurer KH , Ehrenreich P , Baumer S , Henne A , Liesegang H , Merkl R , Ehrenreich A , Gottschalk G
Ref : J Molecular Microbiology Biotechnol , 7 :204 , 2004
Abstract : Veith_2004_J.Mol.Microbiol.Biotechnol_7_204
ESTHER : Veith_2004_J.Mol.Microbiol.Biotechnol_7_204
PubMedSearch : Veith_2004_J.Mol.Microbiol.Biotechnol_7_204
PubMedID: 15383718
Gene_locus related to this paper: bacld-q62u01 , bacld-q62yz9 , bacld-q65dz7 , bacld-q65e02 , bacld-q65eq1 , bacld-q65fc5 , bacld-q65fg2 , bacld-q65fg3 , bacld-q65fk9 , bacld-q65ft3 , bacld-q65fw3 , bacld-q65fy2 , bacld-q65gx2 , bacld-q65hn8 , bacld-q65hr4 , bacld-q65if8 , bacld-q65iy4 , bacld-q65j72 , bacld-q65le0 , bacld-q65ly2 , bacld-q65m29 , bacld-q65mg8 , bacld-q65my7 , bacld-q65n63 , bacld-q65nk2 , bacld-q65nm7 , bacli-LICC