bacld-q65hr4

Bacillus licheniformis; Bacillus sp. Lipase Lip_vut1 from Goat Rumen metagenome lip (lipase)

Comment

"Other strains: Bacillus licheniformis (DSM 13 \/ ATCC 14580\; CG-B52)\; Bacillus sp. RN2"

Relationship

Family : Lipase_2

Block : X

Position in NCBI Life Tree : Bacillus licheniformis

Molecular evidence

No mutation

No kinetic

No disease

No inhibitor

Sequence

Peptide

MRRHSFLSILLICMLSVVSVFSFRPSAASAASHNPVVMVH
GIGGADYNFI GIKSYLQSQGWTSSELYAINFIDKTGNNI
NNAPRLSEYIKRVLNQTGASK VDIVAHSMGGANTLYYIK
NLDGADKVGHVVTLGGANRLVTNTAPQNDKIS YTSIYST
SDYIVLNSLSKLDGANNVQISGVSHVGLLFSSKVNALIKD
GLT ASGK

References

Title : Expression and characterization of a novel lipase from Bacillus licheniformis NCU CS-5 for application in enhancing fatty acids flavor release for low-fat cheeses - Zhao_2022_Food.Chem_368_130868
Author(s) : Zhao J , Ma M , Yan X , Zhang G , Xia J , Zeng G , Tian W , Bao X , Zeng Z , Yu P , Gong D
Ref : Food Chem , 368 :130868 , 2022
Abstract : Zhao_2022_Food.Chem_368_130868
ESTHER : Zhao_2022_Food.Chem_368_130868
PubMedSearch : Zhao_2022_Food.Chem_368_130868
PubMedID: 34438173
Gene_locus related to this paper: bacld-q65hr4

Title : Immobilization of lipase on beta-cyclodextrin grafted and aminopropyl-functionalized chitosan\/Fe(3)O(4) magnetic nanocomposites: An innovative approach to fruity flavor esters esterification - Zhao_2022_Food.Chem_366_130616
Author(s) : Zhao J , Ma M , Yan X , Wan D , Zeng Z , Yu P , Gong D
Ref : Food Chem , 366 :130616 , 2022
Abstract : Zhao_2022_Food.Chem_366_130616
ESTHER : Zhao_2022_Food.Chem_366_130616
PubMedSearch : Zhao_2022_Food.Chem_366_130616
PubMedID: 34311240
Gene_locus related to this paper: bacld-q65hr4

Title : Characterization of a novel lipase from Bacillus licheniformis NCU CS-5 for applications in detergent industry and biodegradation of 2,4-D butyl ester - Zhao_2021_Int.J.Biol.Macromol__
Author(s) : Zhao J , Liu S , Gao Y , Ma M , Yan X , Cheng D , Wan D , Zeng Z , Yu P , Gong D
Ref : Int J Biol Macromol , : , 2021
Abstract : Zhao_2021_Int.J.Biol.Macromol__
ESTHER : Zhao_2021_Int.J.Biol.Macromol__
PubMedSearch : Zhao_2021_Int.J.Biol.Macromol__
PubMedID: 33548313
Gene_locus related to this paper: bacld-q65hr4

Title : Purification and characterization of organic solvent and detergent tolerant lipase from thermotolerant Bacillus sp. RN2 - Kanjanavas_2010_Int.J.Mol.Sci_11_3783
Author(s) : Kanjanavas P , Khuchareontaworn S , Khawsak P , Pakpitcharoen A , Pothivejkul K , Santiwatanakul S , Matsui K , Kajiwara T , Chansiri K
Ref : Int J Mol Sci , 11 :3783 , 2010
Abstract : Kanjanavas_2010_Int.J.Mol.Sci_11_3783
ESTHER : Kanjanavas_2010_Int.J.Mol.Sci_11_3783
PubMedSearch : Kanjanavas_2010_Int.J.Mol.Sci_11_3783
PubMedID: 21152301
Gene_locus related to this paper: bacld-q65hr4

Title : Complete genome sequence of the industrial bacterium Bacillus licheniformis and comparisons with closely related Bacillus species - Rey_2004_Genome.Biol_5_R77
Author(s) : Rey MW , Ramaiya P , Nelson BA , Brody-Karpin SD , Zaretsky EJ , Tang M , Lopez de Leon A , Xiang H , Gusti V , Clausen IG , Olsen PB , Rasmussen MD , Andersen JT , Jorgensen PL , Larsen TS , Sorokin A , Bolotin A , Lapidus A , Galleron N , Ehrlich SD , Berka RM
Ref : Genome Biol , 5 :R77 , 2004
Abstract : Rey_2004_Genome.Biol_5_R77
ESTHER : Rey_2004_Genome.Biol_5_R77
PubMedSearch : Rey_2004_Genome.Biol_5_R77
PubMedID: 15461803
Gene_locus related to this paper: bacld-q62u01 , bacld-Q65L73 , bacld-q62yz9 , bacld-q65dz7 , bacld-q65e02 , bacld-q65eq1 , bacld-q65fc5 , bacld-q65fg2 , bacld-q65fg3 , bacld-q65fk9 , bacld-q65ft3 , bacld-q65fw3 , bacld-q65fy2 , bacld-q65gx2 , bacld-q65hn8 , bacld-q65hr4 , bacld-q65if8 , bacld-q65iy4 , bacld-q65j72 , bacld-q65le0 , bacld-q65ly2 , bacld-q65m29 , bacld-q65mg8 , bacld-q65my7 , bacld-q65n63 , bacld-q65nk2 , bacld-q65nm7 , bacli-LICC

Title : The complete genome sequence of Bacillus licheniformis DSM13, an organism with great industrial potential - Veith_2004_J.Mol.Microbiol.Biotechnol_7_204
Author(s) : Veith B , Herzberg C , Steckel S , Feesche J , Maurer KH , Ehrenreich P , Baumer S , Henne A , Liesegang H , Merkl R , Ehrenreich A , Gottschalk G
Ref : J Molecular Microbiology Biotechnol , 7 :204 , 2004
Abstract : Veith_2004_J.Mol.Microbiol.Biotechnol_7_204
ESTHER : Veith_2004_J.Mol.Microbiol.Biotechnol_7_204
PubMedSearch : Veith_2004_J.Mol.Microbiol.Biotechnol_7_204
PubMedID: 15383718
Gene_locus related to this paper: bacld-q62u01 , bacld-q62yz9 , bacld-q65dz7 , bacld-q65e02 , bacld-q65eq1 , bacld-q65fc5 , bacld-q65fg2 , bacld-q65fg3 , bacld-q65fk9 , bacld-q65ft3 , bacld-q65fw3 , bacld-q65fy2 , bacld-q65gx2 , bacld-q65hn8 , bacld-q65hr4 , bacld-q65if8 , bacld-q65iy4 , bacld-q65j72 , bacld-q65le0 , bacld-q65ly2 , bacld-q65m29 , bacld-q65mg8 , bacld-q65my7 , bacld-q65n63 , bacld-q65nk2 , bacld-q65nm7 , bacli-LICC