capte-ACHE1

Capitella teleta (Capitella sp. I) polychaete worm Annelida acetylcholinesterase 1

Comment

Capitella teleta (Capitella sp. I) is a polychaete worm and a representative member of the phylum Annelida, also known as the segmented worms jgi|Capca1|182179|estExt_Genewise1Plus.C_350103 CAWW1998 CAWT18855 estExt_Genewise1Plus.C_350103 [Capca1:182179] T peptide KDMSEVEKEWKMQFHEWSTNYIVDWKIEFDRYKKRIESCPG H peptide NLTKKALDGRKCGRSEKERKPEVIEPEPLVPNITCASSKSAGFA VSAMDAMFLVFFVLLPPAAL

Relationship

Family : ACHE

Block : C

Position in NCBI Life Tree : Capitella teleta

(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)

> cellular organisms N E > Eukaryota N E > Opisthokonta N E > Metazoa N E > Eumetazoa N E > Bilateria N E > Protostomia N E > Lophotrochozoa N E > Annelida N E > Polychaeta N E > Scolecida N E > Capitellida N E > Capitellidae N E > Capitella N E > Capitella teleta N E

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTMWFLTWGH TAKRKSALWL TCWLLLIFKN VSAARRDDLI VVTEKGRIQG TRHYLPHLGK AVNTFLGIPF AKPPVSHLRF RHPVPVDSWQ GIYNATKAPN SCYQVPDLVF GDFVGSSMWN PTTNVSEDCL YINVWVPKNE KRLRKSAVLV WIYGGGFYSG TSTLNCYDGK VLAAENNIIV VSINYRVGVL GFLSLGHPHA PGNAGLFDQL MGLEWVQQNI RHFGGDPHNV TLFGESAGSA SVSFHLLSPL SQPKFQRAIM QSGTANMPWA TTTPEEGKRR SVELAVDYLG CRDSDMVAII DCLKEFLPNQ LVQKQWVSRG LMQFPFLPVI DGTFLTETPE MSLQRKSFKK CPVLMGSNRN EGSWFLIYDL KDKLASENRS MTQEQFNLSM ETLFGFYPQF PQELNSFGLD AIKFQYSDFL NPENEDRNIA SLESAVAECH FICHVNKFAE AYAAAGENVY MYYFTQRYSS NPWPKWMGVL HGDEILFTFG DPLKPGTSYT EDEKLLSRKM MRYWTNFAKT GDPNRVPGQQ ALGDWPLHTR TGQEYLELNT KFLNYEDKTE AVGRGPRINA CAFWNQYLPQ LVTATKDMSE VEKEWKMQFH EWSTNYIVDW KIEFDRYKKR IESCPG

References (1)

Title : Insights into bilaterian evolution from three spiralian genomes - Simakov_2013_Nature_493_526
Author(s) : Simakov O , Marletaz F , Cho SJ , Edsinger-Gonzales E , Havlak P , Hellsten U , Kuo DH , Larsson T , Lv J , Arendt D , Savage R , Osoegawa K , de Jong P , Grimwood J , Chapman JA , Shapiro H , Aerts A , Otillar RP , Terry AY , Boore JL , Grigoriev IV , Lindberg DR , Seaver EC , Weisblat DA , Putnam NH , Rokhsar DS
Ref : Nature , 493 :526 , 2013
PubMedID: 23254933
Gene_locus related to this paper: capte-r7t7t5 , capte-r7tx98 , capte-r7ua57 , capte-r7ua73 , capte-ACHE1 , capte-ACHE2 , capte-ACHE3 , capte-ACHE4 , helro-ACHE1 , helro-ACHE1b , lotgi-ACHE1 , lotgi-ACHE2 , lotgi-v4aaa2 , lotgi-v3zx52 , lotgi-v4b4v9 , capte-r7tuq9 , capte-r7v997 , capte-r7vgb9 , lotgi-v3zwe9 , capte-r7tu45 , lotgi-v4bvy3 , lotgi-v3zh31 , capte-r7uie6 , lotgi-v4b898 , capte-r7u3w8 , capte-r7uxb2 , lotgi-v3za62 , capte-r7ux79 , capte-r7uq81 , capte-r7vcc3 , capte-r7ts12 , capte-r7u1x0 , capte-r7uhi1 , capte-r7vei7 , capte-r7v0v3 , lotgi-v4bvi8 , lotgi-v3zyd8 , capte-r7tzy6 , lotgi-v3z9i1 , helro-t1fsg3 , capte-x1yv75 , capte-x2b306 , lotgi-v3zcw8 , capte-r7thp6 , helro-t1fy80 , lotgi-v4bky5 , capte-r7tsq9 , lotgi-v4ali9 , lotgi-v4a9f2 , lotgi-v3zjj3 , helro-t1eej5 , helro-t1g9b7 , capte-r7tiy1 , capte-r7tbl5 , helro-t1exa6 , lotgi-v4a5l7 , helro-t1fm33 , capte-r7ud05 , capte-r7tql8 , capte-r7u5g6 , capte-r7u5z3 , capte-r7ue07 , lotgi-v3zk54 , lotgi-v4a4r1 , lotgi-v4aw76 , lotgi-v4b250 , lotgi-v4bbk1 , lotgi-v3zq85 , lotgi-v4a6s5 , lotgi-v4amq2 , lotgi-v4aqm2 , lotgi-v4crq0 , capte-r7tad7 , capte-r7vgm6 , lotgi-v4agl2 , lotgi-v3zur2 , lotgi-v4aui4 , capte-r7tlv8 , lotgi-v3zu07 , helro-t1g0w9