haein-sfgh

Haemophilus influenzae, YAIM SFGH protein hi1084

Comment

"Other strains: Haemophilus influenzae (and strains 86-028NP\; 22.1-21\; PittII\; PittAA\; 3655\; 6P18H1\; RdAW\; ATCC51907\/DSM11121\/KW20\/Rd\; R3021\; PittHH\; PittGG\; NT127\; 7P49H1\; PittEE\; 22.4-21)" || "Q4QP06 Haemophilus influenzae (strain 86-028NP) hypothetical protein Harrison et al"

Relationship

Family : A85-EsteraseD-FGH

Block : X

Position in NCBI Life Tree : Haemophilus influenzae

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MKLIEQHQIFGGSQQVWAHNAQTLQCEMKFAVYLPNNPEN
RPLGVIYWLS GLTCTEQNFITKSGFQRYAAEHQVIVVAP
DTSPRGEQVPNDAAYDLGQGA GFYLNATEQPWATNYQMY
DYILNELPDLIEANFPTNGKRSIMGHSMGGHG ALVLALR
NRERYQSVSAFSPILSPSLVPWGEKAFSAYLGEDREKWQQ
YDA SSLIQQGYKVQGMRIDQGLEDEFLPTQLRTEDFIET
CRVANQPVDVRFHK GYDHSYYFIASFIGEHIAYHAEFLK

References

Title : Characterization and modeling of the Haemophilus influenzae core and supragenomes based on the complete genomic sequences of Rd and 12 clinical nontypeable strains - Hogg_2007_Genome.Biol_8_R103
Author(s) : Hogg JS , Hu FZ , Janto B , Boissy R , Hayes J , Keefe R , Post JC , Ehrlich GD
Ref : Genome Biol , 8 :R103 , 2007
Abstract : Hogg_2007_Genome.Biol_8_R103
ESTHER : Hogg_2007_Genome.Biol_8_R103
PubMedSearch : Hogg_2007_Genome.Biol_8_R103
PubMedID: 17550610
Gene_locus related to this paper: haei8-q4qkr2 , haeif-a4n6l8 , haeif-a4nfi4 , haein-metx , haein-sfgh , haein-y1552 , haein-yfbb

Title : Differential genome contents of nontypeable Haemophilus influenzae strains from adults with chronic obstructive pulmonary disease - Fernaays_2006_Infect.Immun_74_3366
Author(s) : Fernaays MM , Lesse AJ , Sethi S , Cai X , Murphy TF
Ref : Infect Immun , 74 :3366 , 2006
Abstract : Fernaays_2006_Infect.Immun_74_3366
ESTHER : Fernaays_2006_Infect.Immun_74_3366
PubMedSearch : Fernaays_2006_Infect.Immun_74_3366
PubMedID: 16714566
Gene_locus related to this paper: haein-sfgh

Title : Genomic sequence of an otitis media isolate of nontypeable Haemophilus influenzae: comparative study with H. influenzae serotype d, strain KW20 - Harrison_2005_J.Bacteriol_187_4627
Author(s) : Harrison A , Dyer DW , Gillaspy A , Ray WC , Mungur R , Carson MB , Zhong H , Gipson J , Gipson M , Johnson LS , Lewis L , Bakaletz LO , Munson RS, Jr.
Ref : Journal of Bacteriology , 187 :4627 , 2005
Abstract : Harrison_2005_J.Bacteriol_187_4627
ESTHER : Harrison_2005_J.Bacteriol_187_4627
PubMedSearch : Harrison_2005_J.Bacteriol_187_4627
PubMedID: 15968074
Gene_locus related to this paper: haei8-q4qkr2 , haein-HI0193 , haein-metx , haein-pldb , haein-sfgh , haein-yfbb

Title : Two-dimensional map of the proteome of Haemophilus influenzae - Langen_2000_Electrophoresis_21_411
Author(s) : Langen H , Takacs B , Evers S , Berndt P , Lahm HW , Wipf B , Gray C , Fountoulakis M
Ref : Electrophoresis , 21 :411 , 2000
Abstract : Langen_2000_Electrophoresis_21_411
ESTHER : Langen_2000_Electrophoresis_21_411
PubMedSearch : Langen_2000_Electrophoresis_21_411
PubMedID: 10675023
Gene_locus related to this paper: haein-sfgh

Title : Whole-genome random sequencing and assembly of Haemophilus influenzae Rd - Fleischmann_1995_Science_269_496
Author(s) : Fleischmann RD , Adams MD , White O , Clayton RA , Kirkness EF , Kerlavage AR , Bult CJ , Tomb JF , Dougherty BA , Merrick JM , McKenney K , Sutton G , FitzHugh W , Fields C , Gocayne JD , Scott J , Shirley R , Liu LI , Glodek A , Kelley JM , Weidman JF , Phillips CA , Spriggs T , Hedblom E , Cotton MD , Utterback TR , Hanna MC , Nguyen DT , Saudek DM , Brandon RC , FineLD , Fritchman JL , Fuhrmann JL , Geoghagen NS , Gnehm CL , McDonald LA , Keith V , Small KV , Fraser CM , Smith HO , Venter JC
Ref : Science , 269 :496 , 1995
Abstract : Fleischmann_1995_Science_269_496
ESTHER : Fleischmann_1995_Science_269_496
PubMedSearch : Fleischmann_1995_Science_269_496
PubMedID: 7542800
Gene_locus related to this paper: haein-HI0193 , haein-metx , haein-pldb , haein-sfgh , haein-y1552 , haein-yfbb