mouse-4neur

Mus musculus (Mouse) neuroligin 4

Comment

Relationship

Family : Neuroligin

Block : C

Position in NCBI Life Tree : Mus musculus

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MPAPAPALLCLALALASAQPSPPPPPPFPVVATNYGKLRG
VRAALPGDVL GPVTQFLGVPYAAPPTGERRFQPPEPPSS
WAGVRDATRFAPVCPQHLDER ALLRDRLPAWFAANLDAI
AAYVQDQSEDCLYLNLYVPGGANGKKMADDVT GNDHGDD
QDSRDPGVGGAAAAAARKPVMVYIHGGSYMEGTANIVDGS
VLA SYGDVIVVTVNYRLGVLGFLSTGDQAAKGNYGLLDQ
IQALRWVEENAGAF GGDPDRVTVFGSGAGASCVSLLTLS
HYSEGLFQKAIIQSGTALSSWAVNY QPARYARALGERVG
CATPDPGSPPGSPPGWDSASLVSCLRGKAAGELARA RVT
PATYHVAFGPTVDGDVIPDDPQILMEQGEFLNYDIMLGVN
QGEGARF VDGLGGGHDGGYGGYGGGYGGGVEDDEVQDGG
PDGAAGGVSAGEFDLAVS GFINDLYGRPEGRGDALRETV
KFMYTDWADRDSPEARRKTLVALFTDHQW VAPAVATADL
HARYGSPTYFYAFYHRCHGGGGGGGGVDGVAGGVAGGVGG
EEARPAWADAAHGDEVPYVFGVPMAGPGDVFGCNFSRND
VMLSAVVMTYW TNFAKTGDPNQPVAQDTRFVHTRPNRFE
EVAWAKYDPRGQLYLHIGLRPR VRDHYRAAKVAFWLELV
PHLHGLAADPGAYLSAAATRAAPSGDPDRDPGG GGGGRR
RPRPATRRPAVMTSSSMASGSGMTSSSGSGMTSSSGSSAS
AVLI ETRRDYSTELSVTIAVGASLLFLNVLAFAALYYKK
DKRRHETHRRPPPPR PPQAPPSAAAADRNPRPDPGPAGR
RGGECGAVVTAMAAEASAGGLGHDGV GGVGVGGVIGGVA
GLRLACPPDYALTLRRSPDDVPRAGAGPGAMTLIPGA LG
GGGGGAVHGFNTFGSGVGVAGVAGVATSQAGPGLPHGHST
TRV

References

Title : Sex-Specific Microglia State in the Neuroligin-4 Knock-Out Mouse Model of Autism Spectrum Disorder - Guneykaya_2023_Brain.Behav.Immun__
Author(s) : Guneykaya D , Ugursu B , Logiacco F , Popp O , Almut Feiks M , Meyer N , Wendt S , Semtner M , Cherif F , Gauthier C , Madore C , Yin Z , Cinar O , Arslan T , Gerevich Z , Mertins P , Butovsky O , Kettenmann H , Wolf SA
Ref : Brain Behavior & Immunity , : , 2023
Abstract : Guneykaya_2023_Brain.Behav.Immun__
ESTHER : Guneykaya_2023_Brain.Behav.Immun__
PubMedSearch : Guneykaya_2023_Brain.Behav.Immun__
PubMedID: 37001827
Gene_locus related to this paper: mouse-4neur

Title : NLGN4X TCR transgenic T cells to treat gliomas - Kramer_2023_Neuro.Oncol__
Author(s) : Kramer C , Kilian M , Chih YC , Kourtesakis A , Hoffmann DC , Boschert T , Koopmann P , Sanghvi K , De Roia A , Jung S , Jahne K , Day B , Shultz LD , Ratliff M , Harbottle R , Green EW , Will R , Wick W , Platten M , Bunse L
Ref : Neuro Oncol , : , 2023
Abstract : Kramer_2023_Neuro.Oncol__
ESTHER : Kramer_2023_Neuro.Oncol__
PubMedSearch : Kramer_2023_Neuro.Oncol__
PubMedID: 37715782
Gene_locus related to this paper: human-NLGN4X , mouse-4neur

Title : Evolution of the Autism-Associated Neuroligin-4 Gene Reveals Broad Erosion of Pseudoautosomal Regions in Rodents - Maxeiner_2020_Mol.Biol.Evol__
Author(s) : Maxeiner S , Benseler F , Krasteva-Christ G , Brose N , Sudhof TC
Ref : Molecular Biology Evolution , : , 2020
Abstract : Maxeiner_2020_Mol.Biol.Evol__
ESTHER : Maxeiner_2020_Mol.Biol.Evol__
PubMedSearch : Maxeiner_2020_Mol.Biol.Evol__
PubMedID: 32011705
Gene_locus related to this paper: mouse-4neur

Title : Autism-associated neuroligin-4 mutation selectively impairs glycinergic synaptic transmission in mouse brainstem synapses - Zhang_2018_J.Exp.Med_215_1543
Author(s) : Zhang B , Gokce O , Hale WD , Brose N , Sudhof TC
Ref : J Exp Med , 215 :1543 , 2018
Abstract : Zhang_2018_J.Exp.Med_215_1543
ESTHER : Zhang_2018_J.Exp.Med_215_1543
PubMedSearch : Zhang_2018_J.Exp.Med_215_1543
PubMedID: 29724786
Gene_locus related to this paper: mouse-4neur

Title : Unusually rapid evolution of Neuroligin-4 in mice - Bolliger_2008_Proc.Natl.Acad.Sci.U.S.A_105_6421
Author(s) : Bolliger MF , Pei J , Maxeiner S , Boucard AA , Grishin NV , Sudhof TC
Ref : Proc Natl Acad Sci U S A , 105 :6421 , 2008
Abstract : Bolliger_2008_Proc.Natl.Acad.Sci.U.S.A_105_6421
ESTHER : Bolliger_2008_Proc.Natl.Acad.Sci.U.S.A_105_6421
PubMedSearch : Bolliger_2008_Proc.Natl.Acad.Sci.U.S.A_105_6421
PubMedID: 18434543
Gene_locus related to this paper: mouse-4neur

Title : Reduced social interaction and ultrasonic communication in a mouse model of monogenic heritable autism - Jamain_2008_Proc.Natl.Acad.Sci.U.S.A_105_1710
Author(s) : Jamain S , Radyushkin K , Hammerschmidt K , Granon S , Boretius S , Varoqueaux F , Ramanantsoa N , Gallego J , Ronnenberg A , Winter D , Frahm J , Fischer J , Bourgeron T , Ehrenreich H , Brose N
Ref : Proc Natl Acad Sci U S A , 105 :1710 , 2008
Abstract : Jamain_2008_Proc.Natl.Acad.Sci.U.S.A_105_1710
ESTHER : Jamain_2008_Proc.Natl.Acad.Sci.U.S.A_105_1710
PubMedSearch : Jamain_2008_Proc.Natl.Acad.Sci.U.S.A_105_1710
PubMedID: 18227507
Gene_locus related to this paper: mouse-4neur

Title : Mutations of the X-linked genes encoding neuroligins NLGN3 and NLGN4 are associated with autism - Jamain_2003_Nat.Genet_34_27
Author(s) : Jamain S , Quach H , Betancur C , Rastam M , Colineaux C , Gillberg IC , Soderstrom H , Giros B , Leboyer M , Gillberg C , Bourgeron T
Ref : Nat Genet , 34 :27 , 2003
Abstract : Jamain_2003_Nat.Genet_34_27
ESTHER : Jamain_2003_Nat.Genet_34_27
PubMedSearch : Jamain_2003_Nat.Genet_34_27
PubMedID: 12669065
Gene_locus related to this paper: human-NLGN2 , human-NLGN4X , human-NLGN4Y , mouse-4neur , human-NLGN3