human-NLGN4X

Homo sapiens (Human) Neuroligin-4, X-linked (HNLX) Neuroligin4 KIAA0951

Comment

"Neuronal cell surface protein involved in cell-cell-interactions. Homodimer. Interacts with NRXN1 in a calcium-dependent manner. Interacts through its C-terminus with DLG4\/PSD-95 third PDZ domain. In fact Neuroligin4 is neuroligin X on chromosome X a new entry neuroligin 4Y neuroligin Y is created human-neurxx LOC59203 mRNA in fact identical to 4neur is suppressed" || "Neuroligin4 mutated in AUTISM, X-LINKED see Jamain et al, Laumonnier et al, Yan et al. see mutation"

Relationship

Family : Neuroligin

Block : C

Position in NCBI Life Tree : Homo sapiens

Molecular evidence

No mutation

No kinetic

No substrate

No inhibitor

Sequence

Peptide

MSRPQGLLWLPLLFTPVCVMLNSNVLLWLTALAIKFTLID
SQAQYPVVNT NYGKIRGLRTPLPNEILGPVEQYLGVPYA
SPPTGERRFQPPEPPSSWTGI RNTTQFAAVCPQHLDERS
LLHDMLPIWFTANLDTLMTYVQDQNEDCLYLN IYVPTED
DIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVI
VIT INYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEE
NVGAFGGDPKRVTI FGSGAGASCVSLLTLSHYSEGLFQK
AIIQSGTALSSWAVNYQPAKYTRIL ADKVGCNMLDTTDM
VECLRNKNYKELIQQTITPATYHIAFGPVIDGDVIP DDP
QILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPN
DFDFSVS NFVDNLYGYPEGKDTLRETIKFMYTDWADKEN
PETRRKTLVALFTDHQWV APAVATADLHAQYGSPTYFYA
FYHHCQSEMKPSWADSAHGDEVPYVFGIP MIGPTELFSC
NFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTK
PNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAF
WLELVPHLHNL NEIFQYVSTTTKVPPPDMTSFPYGTRRS
PAKIWPTTKRPAITPANNPKHS KDPHKTGPEDTTVLIET
KRDYSTELSVTIAVGASLLFLNILAFAALYYKK DKRRHE
THRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESL
QAHD TLRLTCPPDYTLTLRRSPDDIPLMTPNTITMIPNT
LTGMQPLHTFNTFSG GQNSTNLPHGHSTTRV

References

Title : NLGN4X TCR transgenic T cells to treat gliomas - Kramer_2023_Neuro.Oncol__
Author(s) : Kramer C , Kilian M , Chih YC , Kourtesakis A , Hoffmann DC , Boschert T , Koopmann P , Sanghvi K , De Roia A , Jung S , Jahne K , Day B , Shultz LD , Ratliff M , Harbottle R , Green EW , Will R , Wick W , Platten M , Bunse L
Ref : Neuro Oncol , : , 2023
Abstract : Kramer_2023_Neuro.Oncol__
ESTHER : Kramer_2023_Neuro.Oncol__
PubMedSearch : Kramer_2023_Neuro.Oncol__
PubMedID: 37715782
Gene_locus related to this paper: human-NLGN4X , mouse-4neur

Title : An Autism-Associated Mutation Impairs Neuroligin-4 Glycosylation and Enhances Excitatory Synaptic Transmission in Human Neurons - Cast_2021_J.Neurosci_41_392
Author(s) : Cast TP , Boesch DJ , Smyth K , Shaw AE , Ghebrial M , Chanda S
Ref : Journal of Neuroscience , 41 :392 , 2021
Abstract : Cast_2021_J.Neurosci_41_392
ESTHER : Cast_2021_J.Neurosci_41_392
PubMedSearch : Cast_2021_J.Neurosci_41_392
PubMedID: 33268543
Gene_locus related to this paper: human-NLGN4X

Title : Pathogenic paternally inherited NLGN4X deletion in a female with autism spectrum disorder: Clinical, cytogenetic, and molecular characterization - Kopp_2020_Am.J.Med.Genet.A__e62025
Author(s) : Kopp N , Amarillo I , Martinez-Agosto J , Quintero-Rivera F
Ref : American Journal of Medicine Genet A , :e62025 , 2020
Abstract : Kopp_2020_Am.J.Med.Genet.A__e62025
ESTHER : Kopp_2020_Am.J.Med.Genet.A__e62025
PubMedSearch : Kopp_2020_Am.J.Med.Genet.A__e62025
PubMedID: 33369065
Gene_locus related to this paper: human-NLGN4X

Title : Elevated plasma X-linked neuroligin 4 expression is associated with autism spectrum disorder - Alayadhi_2020_Med.Princ.Pract__
Author(s) : Alayadhi LY , Qasem H , Alghamdi HAM , Elamin NE
Ref : Med Princ Pract , : , 2020
Abstract : Alayadhi_2020_Med.Princ.Pract__
ESTHER : Alayadhi_2020_Med.Princ.Pract__
PubMedSearch : Alayadhi_2020_Med.Princ.Pract__
PubMedID: 32155636
Gene_locus related to this paper: human-NLGN4X

Title : A Cluster of Autism-Associated Variants on X-Linked NLGN4X Functionally Resemble NLGN4Y - Nguyen_2020_Neuron_106_759
Author(s) : Nguyen TA , Wu K , Pandey S , Lehr AW , Li Y , Bemben MA , Badger JD, 2nd , Lauzon JL , Wang T , Zaghloul KA , Thurm A , Jain M , Lu W , Roche KW
Ref : Neuron , 106 :759 , 2020
Abstract : Nguyen_2020_Neuron_106_759
ESTHER : Nguyen_2020_Neuron_106_759
PubMedSearch : Nguyen_2020_Neuron_106_759
PubMedID: 32243781
Gene_locus related to this paper: human-NLGN4X

Title : Analysis of the SNP rs3747333 and rs3747334 in NLGN4X gene in autism spectrum disorder: a meta-analysis - Sun_2019_Ann.Gen.Psychiatry_18_6
Author(s) : Sun H , Yang Y , Zhang L , Wu H , Zhang H , Li H
Ref : Ann Gen Psychiatry , 18 :6 , 2019
Abstract : Sun_2019_Ann.Gen.Psychiatry_18_6
ESTHER : Sun_2019_Ann.Gen.Psychiatry_18_6
PubMedSearch : Sun_2019_Ann.Gen.Psychiatry_18_6
PubMedID: 31139237
Gene_locus related to this paper: human-NLGN4X

Title : Not all neuroligin 3 and 4X missense variants lead to significant functional inactivation - Xu_2017_Brain.Behav_7_e00793
Author(s) : Xu X , Hu Z , Zhang L , Liu H , Cheng Y , Xia K , Zhang X
Ref : Brain Behav , 7 :e00793 , 2017
Abstract : Xu_2017_Brain.Behav_7_e00793
ESTHER : Xu_2017_Brain.Behav_7_e00793
PubMedSearch : Xu_2017_Brain.Behav_7_e00793
PubMedID: 28948087
Gene_locus related to this paper: human-NLGN4X

Title : Neuroligin 4X overexpression in human breast cancer is associated with poor relapse-free survival - Henderson_2017_PLoS.One_12_e0189662
Author(s) : Henderson HJ , Karanam B , Samant R , Vig K , Singh SR , Yates C , Bedi D
Ref : PLoS ONE , 12 :e0189662 , 2017
Abstract : Henderson_2017_PLoS.One_12_e0189662
ESTHER : Henderson_2017_PLoS.One_12_e0189662
PubMedSearch : Henderson_2017_PLoS.One_12_e0189662
PubMedID: 29244827
Gene_locus related to this paper: human-NLGN4X

Title : Analysis of the genes encoding neuroligins NLGN3 and NLGN4 in Bulgarian patients with autism - Avdjieva-Tzavella_2012_Genet.Couns_23_505
Author(s) : Avdjieva-Tzavella DM , Todorov TP , Todorova AP , Kirov AV , Hadjidekova SP , Rukova BB , Litvinenko IO , Hristova-Naydenova DN , Tincheva RS , Toncheva DI
Ref : Genet Couns , 23 :505 , 2012
Abstract : Avdjieva-Tzavella_2012_Genet.Couns_23_505
ESTHER : Avdjieva-Tzavella_2012_Genet.Couns_23_505
PubMedSearch : Avdjieva-Tzavella_2012_Genet.Couns_23_505
PubMedID: 23431752
Gene_locus related to this paper: human-NLGN4X

Title : Structural insights into the exquisite selectivity of neurexin\/neuroligin synaptic interactions - Leone_2010_EMBO.J_29_2461
Author(s) : Leone P , Comoletti D , Ferracci G , Conrod S , Garcia SU , Taylor P , Bourne Y , Marchot P
Ref : EMBO Journal , 29 :2461 , 2010
Abstract : Leone_2010_EMBO.J_29_2461
ESTHER : Leone_2010_EMBO.J_29_2461
PubMedSearch : Leone_2010_EMBO.J_29_2461
PubMedID: 20543817
Gene_locus related to this paper: human-NLGN4X

Title : Structural analysis of the synaptic protein neuroligin and its beta-neurexin complex: determinants for folding and cell adhesion - Fabrichny_2007_Neuron_56_979
Author(s) : Fabrichny IP , Leone P , Sulzenbacher G , Comoletti D , Miller MT , Taylor P , Bourne Y , Marchot P
Ref : Neuron , 56 :979 , 2007
Abstract : Fabrichny_2007_Neuron_56_979
ESTHER : Fabrichny_2007_Neuron_56_979
PubMedSearch : Fabrichny_2007_Neuron_56_979
PubMedID: 18093521
Gene_locus related to this paper: human-NLGN4X

Title : Neuroligin-3 is a neuronal adhesion protein at GABAergic and glutamatergic synapses - Budreck_2007_Eur.J.Neurosci_26_1738
Author(s) : Budreck EC , Scheiffele P
Ref : European Journal of Neuroscience , 26 :1738 , 2007
Abstract : Budreck_2007_Eur.J.Neurosci_26_1738
ESTHER : Budreck_2007_Eur.J.Neurosci_26_1738
PubMedSearch : Budreck_2007_Eur.J.Neurosci_26_1738
PubMedID: 17897391
Gene_locus related to this paper: human-NLGN3 , human-NLGN4X

Title : Adhesion molecules in the nervous system: structural insights into function and diversity - Shapiro_2007_Annu.Rev.Neurosci_30_451
Author(s) : Shapiro L , Love J , Colman DR
Ref : Annual Review of Neuroscience , 30 :451 , 2007
Abstract : Shapiro_2007_Annu.Rev.Neurosci_30_451
ESTHER : Shapiro_2007_Annu.Rev.Neurosci_30_451
PubMedSearch : Shapiro_2007_Annu.Rev.Neurosci_30_451
PubMedID: 17600523
Gene_locus related to this paper: human-NLGN3 , human-NLGN4X

Title : Neuroligins 3 and 4X interact with syntrophin-gamma2, and the interactions are affected by autism-related mutations - Yamakawa_2007_Biochem.Biophys.Res.Commun_355_41
Author(s) : Yamakawa H , Oyama S , Mitsuhashi H , Sasagawa N , Uchino S , Kohsaka S , Ishiura S
Ref : Biochemical & Biophysical Research Communications , 355 :41 , 2007
Abstract : Yamakawa_2007_Biochem.Biophys.Res.Commun_355_41
ESTHER : Yamakawa_2007_Biochem.Biophys.Res.Commun_355_41
PubMedSearch : Yamakawa_2007_Biochem.Biophys.Res.Commun_355_41
PubMedID: 17292328
Gene_locus related to this paper: human-NLGN3 , human-NLGN4X

Title : Neuroscience. Autism's cause may reside in abnormalities at the synapse -
Author(s) : Garber K
Ref : Science , 317 :190 , 2007
PubMedID: 17626859
Gene_locus related to this paper: human-NLGN3 , human-NLGN4X

Title : Synaptic arrangement of the neuroligin\/beta-neurexin complex revealed by X-ray and neutron scattering - Comoletti_2007_Structure_15_693
Author(s) : Comoletti D , Grishaev A , Whitten AE , Tsigelny I , Taylor P , Trewhella J
Ref : Structure , 15 :693 , 2007
Abstract : Comoletti_2007_Structure_15_693
ESTHER : Comoletti_2007_Structure_15_693
PubMedSearch : Comoletti_2007_Structure_15_693
PubMedID: 17562316
Gene_locus related to this paper: human-NLGN3 , human-NLGN4X

Title : A neuroligin-3 mutation implicated in autism increases inhibitory synaptic transmission in mice - Tabuchi_2007_Science_318_71
Author(s) : Tabuchi K , Blundell J , Etherton MR , Hammer RE , Liu X , Powell CM , Sudhof TC
Ref : Science , 318 :71 , 2007
Abstract : Tabuchi_2007_Science_318_71
ESTHER : Tabuchi_2007_Science_318_71
PubMedSearch : Tabuchi_2007_Science_318_71
PubMedID: 17823315
Gene_locus related to this paper: human-NLGN3 , human-NLGN4X

Title : Neurexin-neuroligin signaling in synapse development - Craig_2007_Curr.Opin.Neurobiol_17_43
Author(s) : Craig AM , Kang Y
Ref : Current Opinion in Neurobiology , 17 :43 , 2007
Abstract : Craig_2007_Curr.Opin.Neurobiol_17_43
ESTHER : Craig_2007_Curr.Opin.Neurobiol_17_43
PubMedSearch : Craig_2007_Curr.Opin.Neurobiol_17_43
PubMedID: 17275284
Gene_locus related to this paper: human-NLGN3 , human-NLGN4X

Title : Medicine. Testing hypotheses about autism -
Author(s) : Crawley JN
Ref : Science , 318 :56 , 2007
PubMedID: 17916718
Gene_locus related to this paper: human-NLGN3 , human-NLGN4X

Title : Neurexin Ibeta and neuroligin are localized on opposite membranes in mature central synapses - Berninghausen_2007_J.Neurochem_103_1855
Author(s) : Berninghausen O , Rahman MA , Silva JP , Davletov B , Hopkins C , Ushkaryov YA
Ref : Journal of Neurochemistry , 103 :1855 , 2007
Abstract : Berninghausen_2007_J.Neurochem_103_1855
ESTHER : Berninghausen_2007_J.Neurochem_103_1855
PubMedSearch : Berninghausen_2007_J.Neurochem_103_1855
PubMedID: 17868325
Gene_locus related to this paper: human-NLGN3 , human-NLGN4X

Title : NLGN3\/NLGN4 gene mutations are not responsible for autism in the Quebec population - Gauthier_2005_Am.J.Med.Genet.B.Neuropsychiatr.Genet_132B_74
Author(s) : Gauthier J , Bonnel A , St-Onge J , Karemera L , Laurent S , Mottron L , Fombonne E , Joober R , Rouleau GA
Ref : American Journal of Medicine Genet B Neuropsychiatr Genet , 132B :74 , 2005
Abstract : Gauthier_2005_Am.J.Med.Genet.B.Neuropsychiatr.Genet_132B_74
ESTHER : Gauthier_2005_Am.J.Med.Genet.B.Neuropsychiatr.Genet_132B_74
PubMedSearch : Gauthier_2005_Am.J.Med.Genet.B.Neuropsychiatr.Genet_132B_74
PubMedID: 15389766
Gene_locus related to this paper: human-NLGN4X

Title : Analysis of four neuroligin genes as candidates for autism - Ylisaukko-oja_2005_Eur.J.Hum.Genet_13_1285
Author(s) : Ylisaukko-oja T , Rehnstrom K , Auranen M , Vanhala R , Alen R , Kempas E , Ellonen P , Turunen JA , Makkonen I , Riikonen R , Nieminen-von Wendt T , von Wendt L , Peltonen L , Jarvela I
Ref : Eur J Hum Genet , 13 :1285 , 2005
Abstract : Ylisaukko-oja_2005_Eur.J.Hum.Genet_13_1285
ESTHER : Ylisaukko-oja_2005_Eur.J.Hum.Genet_13_1285
PubMedSearch : Ylisaukko-oja_2005_Eur.J.Hum.Genet_13_1285
PubMedID: 16077734
Gene_locus related to this paper: human-NLGN4Y , human-NLGN1 , human-NLGN3 , human-NLGN4X

Title : Analysis of the neuroligin 3 and 4 genes in autism and other neuropsychiatric patients -
Author(s) : Yan J , Oliveira G , Coutinho A , Yang C , Feng J , Katz C , Sram J , Bockholt A , Jones IR , Craddock N , Cook EH, Jr. , Vicente A , Sommer SS
Ref : Mol Psychiatry , 10 :329 , 2005
PubMedID: 15622415
Gene_locus related to this paper: human-NLGN3 , human-NLGN4X

Title : The DNA sequence of the human X chromosome - Ross_2005_Nature_434_325
Author(s) : Ross MT , Grafham DV , Coffey AJ , Scherer S , McLay K , Muzny D , Platzer M , Howell GR , Burrows C , Bird CP , Frankish A , Lovell FL , Howe KL , Ashurst JL , Fulton RS , Sudbrak R , Wen G , Jones MC , Hurles ME , Andrews TD , Scott CE , Searle S , Ramser J , Whittaker A , Deadman R , Carter NP , Hunt SE , Chen R , Cree A , Gunaratne P , Havlak P , Hodgson A , Metzker ML , Richards S , Scott G , Steffen D , Sodergren E , Wheeler DA , Worley KC , Ainscough R , Ambrose KD , Ansari-Lari MA , Aradhya S , Ashwell RI , Babbage AK , Bagguley CL , Ballabio A , Banerjee R , Barker GE , Barlow KF , Barrett IP , Bates KN , Beare DM , Beasley H , Beasley O , Beck A , Bethel G , Blechschmidt K , Brady N , Bray-Allen S , Bridgeman AM , Brown AJ , Brown MJ , Bonnin D , Bruford EA , Buhay C , Burch P , Burford D , Burgess J , Burrill W , Burton J , Bye JM , Carder C , Carrel L , Chako J , Chapman JC , Chavez D , Chen E , Chen G , Chen Y , Chen Z , Chinault C , Ciccodicola A , Clark SY , Clarke G , Clee CM , Clegg S , Clerc-Blankenburg K , Clifford K , Cobley V , Cole CG , Conquer JS , Corby N , Connor RE , David R , Davies J , Davis C , Davis J , Delgado O , Deshazo D , Dhami P , Ding Y , Dinh H , Dodsworth S , Draper H , Dugan-Rocha S , Dunham A , Dunn M , Durbin KJ , Dutta I , Eades T , Ellwood M , Emery-Cohen A , Errington H , Evans KL , Faulkner L , Francis F , Frankland J , Fraser AE , Galgoczy P , Gilbert J , Gill R , Glockner G , Gregory SG , Gribble S , Griffiths C , Grocock R , Gu Y , Gwilliam R , Hamilton C , Hart EA , Hawes A , Heath PD , Heitmann K , Hennig S , Hernandez J , Hinzmann B , Ho S , Hoffs M , Howden PJ , Huckle EJ , Hume J , Hunt PJ , Hunt AR , Isherwood J , Jacob L , Johnson D , Jones S , de Jong PJ , Joseph SS , Keenan S , Kelly S , Kershaw JK , Khan Z , Kioschis P , Klages S , Knights AJ , Kosiura A , Kovar-Smith C , Laird GK , Langford C , Lawlor S , Leversha M , Lewis L , Liu W , Lloyd C , Lloyd DM , Loulseged H , Loveland JE , Lovell JD , Lozado R , Lu J , Lyne R , Ma J , Maheshwari M , Matthews LH , McDowall J , Mclaren S , McMurray A , Meidl P , Meitinger T , Milne S , Miner G , Mistry SL , Morgan M , Morris S , Muller I , Mullikin JC , Nguyen N , Nordsiek G , Nyakatura G , O'Dell CN , Okwuonu G , Palmer S , Pandian R , Parker D , Parrish J , Pasternak S , Patel D , Pearce AV , Pearson DM , Pelan SE , Perez L , Porter KM , Ramsey Y , Reichwald K , Rhodes S , Ridler KA , Schlessinger D , Schueler MG , Sehra HK , Shaw-Smith C , Shen H , Sheridan EM , Shownkeen R , Skuce CD , Smith ML , Sotheran EC , Steingruber HE , Steward CA , Storey R , Swann RM , Swarbreck D , Tabor PE , Taudien S , Taylor T , Teague B , Thomas K , Thorpe A , Timms K , Tracey A , Trevanion S , Tromans AC , d'Urso M , Verduzco D , Villasana D , Waldron L , Wall M , Wang Q , Warren J , Warry GL , Wei X , West A , Whitehead SL , Whiteley MN , Wilkinson JE , Willey DL , Williams G , Williams L , Williamson A , Williamson H , Wilming L , Woodmansey RL , Wray PW , Yen J , Zhang J , Zhou J , Zoghbi H , Zorilla S , Buck D , Reinhardt R , Poustka A , Rosenthal A , Lehrach H , Meindl A , Minx PJ , Hillier LW , Willard HF , Wilson RK , Waterston RH , Rice CM , Vaudin M , Coulson A , Nelson DL , Weinstock G , Sulston JE , Durbin R , Hubbard T , Gibbs RA , Beck S , Rogers J , Bentley DR
Ref : Nature , 434 :325 , 2005
Abstract : Ross_2005_Nature_434_325
ESTHER : Ross_2005_Nature_434_325
PubMedSearch : Ross_2005_Nature_434_325
PubMedID: 15772651
Gene_locus related to this paper: human-NLGN3 , human-NLGN4X

Title : Complete sequencing and characterization of 21,243 full-length human cDNAs - Ota_2004_Nat.Genet_36_40
Author(s) : Ota T , Suzuki Y , Nishikawa T , Otsuki T , Sugiyama T , Irie R , Wakamatsu A , Hayashi K , Sato H , Nagai K , Kimura K , Makita H , Sekine M , Obayashi M , Nishi T , Shibahara T , Tanaka T , Ishii S , Yamamoto J , Saito K , Kawai Y , Isono Y , Nakamura Y , Nagahari K , Murakami K , Yasuda T , Iwayanagi T , Wagatsuma M , Shiratori A , Sudo H , Hosoiri T , Kaku Y , Kodaira H , Kondo H , Sugawara M , Takahashi M , Kanda K , Yokoi T , Furuya T , Kikkawa E , Omura Y , Abe K , Kamihara K , Katsuta N , Sato K , Tanikawa M , Yamazaki M , Ninomiya K , Ishibashi T , Yamashita H , Murakawa K , Fujimori K , Tanai H , Kimata M , Watanabe M , Hiraoka S , Chiba Y , Ishida S , Ono Y , Takiguchi S , Watanabe S , Yosida M , Hotuta T , Kusano J , Kanehori K , Takahashi-Fujii A , Hara H , Tanase TO , Nomura Y , Togiya S , Komai F , Hara R , Takeuchi K , Arita M , Imose N , Musashino K , Yuuki H , Oshima A , Sasaki N , Aotsuka S , Yoshikawa Y , Matsunawa H , Ichihara T , Shiohata N , Sano S , Moriya S , Momiyama H , Satoh N , Takami S , Terashima Y , Suzuki O , Nakagawa S , Senoh A , Mizoguchi H , Goto Y , Shimizu F , Wakebe H , Hishigaki H , Watanabe T , Sugiyama A , Takemoto M , Kawakami B , Watanabe K , Kumagai A , Itakura S , Fukuzumi Y , Fujimori Y , Komiyama M , Tashiro H , Tanigami A , Fujiwara T , Ono T , Yamada K , Fujii Y , Ozaki K , Hirao M , Ohmori Y , Kawabata A , Hikiji T , Kobatake N , Inagaki H , Ikema Y , Okamoto S , Okitani R , Kawakami T , Noguchi S , Itoh T , Shigeta K , Senba T , Matsumura K , Nakajima Y , Mizuno T , Morinaga M , Sasaki M , Togashi T , Oyama M , Hata H , Komatsu T , Mizushima-Sugano J , Satoh T , Shirai Y , Takahashi Y , Nakagawa K , Okumura K , Nagase T , Nomura N , Kikuchi H , Masuho Y , Yamashita R , Nakai K , Yada T , Ohara O , Isogai T , Sugano S
Ref : Nat Genet , 36 :40 , 2004
Abstract : Ota_2004_Nat.Genet_36_40
ESTHER : Ota_2004_Nat.Genet_36_40
PubMedSearch : Ota_2004_Nat.Genet_36_40
PubMedID: 14702039
Gene_locus related to this paper: human-ABHD1 , human-ABHD4 , human-ABHD12 , human-ABHD16A , human-ACOT1 , human-LDAH , human-ABHD18 , human-CES1 , human-CES4A , human-CES5A , human-CPVL , human-DAGLB , human-EPHX2 , human-KANSL3 , human-LIPA , human-LPL , human-MEST , human-NDRG1 , human-NLGN1 , human-NLGN4X , human-PRCP , human-PRSS16 , human-SERAC1 , human-TMEM53

Title : X-linked mental retardation and autism are associated with a mutation in the NLGN4 gene, a member of the neuroligin family - Laumonnier_2004_Am.J.Hum.Genet_74_552
Author(s) : Laumonnier F , Bonnet-Brilhault F , Gomot M , Blanc R , David A , Moizard MP , Raynaud M , Ronce N , Lemonnier E , Calvas P , Laudier B , Chelly J , Fryns JP , Ropers HH , Hamel BC , Andres C , Barthelemy C , Moraine C , Briault S
Ref : American Journal of Human Genetics , 74 :552 , 2004
Abstract : Laumonnier_2004_Am.J.Hum.Genet_74_552
ESTHER : Laumonnier_2004_Am.J.Hum.Genet_74_552
PubMedSearch : Laumonnier_2004_Am.J.Hum.Genet_74_552
PubMedID: 14963808
Gene_locus related to this paper: human-NLGN4X

Title : Mutations of the X-linked genes encoding neuroligins NLGN3 and NLGN4 are associated with autism - Jamain_2003_Nat.Genet_34_27
Author(s) : Jamain S , Quach H , Betancur C , Rastam M , Colineaux C , Gillberg IC , Soderstrom H , Giros B , Leboyer M , Gillberg C , Bourgeron T
Ref : Nat Genet , 34 :27 , 2003
Abstract : Jamain_2003_Nat.Genet_34_27
ESTHER : Jamain_2003_Nat.Genet_34_27
PubMedSearch : Jamain_2003_Nat.Genet_34_27
PubMedID: 12669065
Gene_locus related to this paper: human-NLGN2 , human-NLGN4X , human-NLGN4Y , mouse-4neur , human-NLGN3

Title : Identification of a novel neuroligin in humans which binds to PSD-95 and has a widespread expression - Bolliger_2001_Biochem.J_356_581
Author(s) : Bolliger MF , Frei K , Winterhalter KH , Gloor SM
Ref : Biochemical Journal , 356 :581 , 2001
Abstract : Bolliger_2001_Biochem.J_356_581
ESTHER : Bolliger_2001_Biochem.J_356_581
PubMedSearch : Bolliger_2001_Biochem.J_356_581
PubMedID: 11368788
Gene_locus related to this paper: human-NLGN4X

Title : The sequence of the human genome - Venter_2001_Science_291_1304
Author(s) : Venter JC , Adams MD , Myers EW , Li PW , Mural RJ , Sutton GG , Smith HO , Yandell M , Evans CA , Holt RA , Gocayne JD , Amanatides P , Ballew RM , Huson DH , Wortman JR , Zhang Q , Kodira CD , Zheng XH , Chen L , Skupski M , Subramanian G , Thomas PD , Zhang J , Gabor Miklos GL , Nelson C , Broder S , Clark AG , Nadeau J , McKusick VA , Zinder N , Levine AJ , Roberts RJ , Simon M , Slayman C , Hunkapiller M , Bolanos R , Delcher A , Dew I , Fasulo D , Flanigan M , Florea L , Halpern A , Hannenhalli S , Kravitz S , Levy S , Mobarry C , Reinert K , Remington K , Abu-Threideh J , Beasley E , Biddick K , Bonazzi V , Brandon R , Cargill M , Chandramouliswaran I , Charlab R , Chaturvedi K , Deng Z , Di Francesco V , Dunn P , Eilbeck K , Evangelista C , Gabrielian AE , Gan W , Ge W , Gong F , Gu Z , Guan P , Heiman TJ , Higgins ME , Ji RR , Ke Z , Ketchum KA , Lai Z , Lei Y , Li Z , Li J , Liang Y , Lin X , Lu F , Merkulov GV , Milshina N , Moore HM , Naik AK , Narayan VA , Neelam B , Nusskern D , Rusch DB , Salzberg S , Shao W , Shue B , Sun J , Wang Z , Wang A , Wang X , Wang J , Wei M , Wides R , Xiao C , Yan C , Yao A , Ye J , Zhan M , Zhang W , Zhang H , Zhao Q , Zheng L , Zhong F , Zhong W , Zhu S , Zhao S , Gilbert D , Baumhueter S , Spier G , Carter C , Cravchik A , Woodage T , Ali F , An H , Awe A , Baldwin D , Baden H , Barnstead M , Barrow I , Beeson K , Busam D , Carver A , Center A , Cheng ML , Curry L , Danaher S , Davenport L , Desilets R , Dietz S , Dodson K , Doup L , Ferriera S , Garg N , Gluecksmann A , Hart B , Haynes J , Haynes C , Heiner C , Hladun S , Hostin D , Houck J , Howland T , Ibegwam C , Johnson J , Kalush F , Kline L , Koduru S , Love A , Mann F , May D , McCawley S , McIntosh T , McMullen I , Moy M , Moy L , Murphy B , Nelson K , Pfannkoch C , Pratts E , Puri V , Qureshi H , Reardon M , Rodriguez R , Rogers YH , Romblad D , Ruhfel B , Scott R , Sitter C , Smallwood M , Stewart E , Strong R , Suh E , Thomas R , Tint NN , Tse S , Vech C , Wang G , Wetter J , Williams S , Williams M , Windsor S , Winn-Deen E , Wolfe K , Zaveri J , Zaveri K , Abril JF , Guigo R , Campbell MJ , Sjolander KV , Karlak B , Kejariwal A , Mi H , Lazareva B , Hatton T , Narechania A , Diemer K , Muruganujan A , Guo N , Sato S , Bafna V , Istrail S , Lippert R , Schwartz R , Walenz B , Yooseph S , Allen D , Basu A , Baxendale J , Blick L , Caminha M , Carnes-Stine J , Caulk P , Chiang YH , Coyne M , Dahlke C , Mays A , Dombroski M , Donnelly M , Ely D , Esparham S , Fosler C , Gire H , Glanowski S , Glasser K , Glodek A , Gorokhov M , Graham K , Gropman B , Harris M , Heil J , Henderson S , Hoover J , Jennings D , Jordan C , Jordan J , Kasha J , Kagan L , Kraft C , Levitsky A , Lewis M , Liu X , Lopez J , Ma D , Majoros W , McDaniel J , Murphy S , Newman M , Nguyen T , Nguyen N , Nodell M , Pan S , Peck J , Peterson M , Rowe W , Sanders R , Scott J , Simpson M , Smith T , Sprague A , Stockwell T , Turner R , Venter E , Wang M , Wen M , Wu D , Wu M , Xia A , Zandieh A , Zhu X
Ref : Science , 291 :1304 , 2001
Abstract : Venter_2001_Science_291_1304
ESTHER : Venter_2001_Science_291_1304
PubMedSearch : Venter_2001_Science_291_1304
PubMedID: 11181995
Gene_locus related to this paper: human-AADAC , human-ABHD1 , human-ABHD10 , human-ABHD11 , human-ACHE , human-BCHE , human-LDAH , human-ABHD18 , human-CMBL , human-ABHD17A , human-KANSL3 , human-LIPA , human-LYPLAL1 , human-NDRG2 , human-NLGN3 , human-NLGN4X , human-NLGN4Y , human-PAFAH2 , human-PREPL , human-RBBP9 , human-SPG21

Title : Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro - Nagase_1999_DNA.Res_6_337
Author(s) : Nagase T , Ishikawa K , Kikuno R , Hirosawa M , Nomura N , Ohara O
Ref : DNA Research , 6 :337 , 1999
Abstract : Nagase_1999_DNA.Res_6_337
ESTHER : Nagase_1999_DNA.Res_6_337
PubMedSearch : Nagase_1999_DNA.Res_6_337
PubMedID: 10574462
Gene_locus related to this paper: human-NDRG2 , human-NLGN4X

Title : Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro - Nagase_1999_DNA.Res_6_63
Author(s) : Nagase T , Ishikawa K , Suyama M , Kikuno R , Hirosawa M , Miyajima N , Tanaka A , Kotani H , Nomura N , Ohara O
Ref : DNA Research , 6 :63 , 1999
Abstract : Nagase_1999_DNA.Res_6_63
ESTHER : Nagase_1999_DNA.Res_6_63
PubMedSearch : Nagase_1999_DNA.Res_6_63
PubMedID: 10231032
Gene_locus related to this paper: human-NLGN3 , human-NLGN4X , human-NLGN4Y

Title : Binding of neuroligins to PSD-95 - Irie_1997_Science_277_1511
Author(s) : Irie M , Hata Y , Takeuchi M , Ichtchenko K , Toyoda A , Hirao K , Takai Y , Rosahl TW , Sudhof TC
Ref : Science , 277 :1511 , 1997
Abstract : Irie_1997_Science_277_1511
ESTHER : Irie_1997_Science_277_1511
PubMedSearch : Irie_1997_Science_277_1511
PubMedID: 9278515
Gene_locus related to this paper: human-NLGN1 , human-NLGN2 , human-NLGN3 , human-NLGN4X