nemve-a7s6g4

Nematostella vectensis (Starlet sea anemone) Lipase

Comment

Relationship

Family : Acidic_Lipase

Block : X

Position in NCBI Life Tree : Nematostella vectensis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MRSLVFVTCLYIAHALPFIHREATTDEPPRDPDIDRNASQ
LIRNRGYPVE EHYVTTSDGFILNLQRIPHGRNELREGSG
RKPVVFLQHGLLMDSTNWVLN SPHDSLGYILADKGFDVW
LGNIRGNEYSAAHVKWNKDSSKFWDWTWQQMA QYDLPAM
IDYVTLATSQSQVFYVGHSQGTLIGFTGFSANQELAKKIK
MFF ALAPVYTVAHVSEFIKASAYALFPVTHIFQNHVSEE
FVPSKLTKMMSDAG VCSRAKSEELCYKTGETLFGFDSSN
LNMSRVPVIMSHWGSGTSFKNMVHF GQMVTSGKCQKYNY
GYFYNWMKYGQIDPPHYRVKDMDVPTVLFSGSHDTL ADP
LDVGELKPRIQNLVHSEEIPGWNHADFLFGMDAERLLYRK
IVKMMFK RIREDNVPQPIDGNDFIASFLGWNKIKN

References