nemve-a7sjw1

Nematostella vectensis (Starlet sea anemone) Predicted protein

Comment

Relationship

Family : Prolylcarboxypeptidase

Block : X

Position in NCBI Life Tree : Nematostella vectensis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

LDHFNFRTSATFSQRYLVNIANWRKGGPIFFYTGNEGDIT
WFANNTGFMW DNAKEFGAMLVFAEHRYYGETLPFGKRSY
ESPKYLGYLSSEQALADFATL IRHIKLTTPGATGSPVIA
IGGSYGGMLSSWIRMKYPNLVTAALAASAPIL YFQGLTP
CEGFNEIVTKDFHRDGGDSCVNSIRKSWSVIEKLGATQSG
RKT LTSVFNTCSPIKTKYNVTQLQDWLSETWANLAMVNY
PYAATFLEPLPAWP IKKVCSHLTDADLPDVALLKAVAGA
VGVYYNSSGQAKCFNLSQQAVSSLG DKGWDFQACTEMVM
PMCSDGVNDMFKPVKWDFEAFAESCQGSYGVKPRQY WVE
VQYGGRDISAHSNIIFSNGLLDPWFAGGVTKSLSPSLVAV
LVEEGAH HLDLRHSNPADPPSLIKARQTEKEYLHRWISE
YYKN

References