phavu-v7bpt6

Phaseolus vulgaris (Kidney bean) (French bean). AB hydrolase-1 domain-containing protein

Comment

Relationship

Family : Auxin-response-4

Block : X

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAIITEEPEPELQQRQQEQPRKPKSKPPSSPPPQSNTDNS
NNNPFSFWFY FILSVSLLSLIFVFTSSLSPRDPKAWFLT
LPTSLRHHYSNGRAIKVQTHP NETPIQVFTFQEGLTSSE
NVVIVHGQGLSSYSYRQLAKSLAAEGVHVTTV DLPGHGF
SEKSVEVSVEGVDGVLGRFQYVYSEIQEKGVFWAFDQMVE
TGQ IPYEEIQARMSKRKVRKPVDLGPEEMGKVLGEVIDS
MGLAPVHLVLHDSA LGMSADFVSERAELVRSLTLIDTAL
YGAFPLWVLEVPVVREVVLGVSFVY AKVVALCCSKRVDV
VDSDALRMLLKGRDGRRAVVNVGKRVNSSFDLAEWG EGL
KGMPMQVLWSAGWSQEWSQEGDRVANALPQASFVTHSGGR
WAQEDAA VEIADKISQFVLSLPKSVRKVEQESIPEHIQK
KLDEAKSSVHDHHHHHSH GHDHHHHHSHGYDHYDEL

References

Title : A reference genome for common bean and genome-wide analysis of dual domestications - Schmutz_2014_Nat.Genet_46_707
Author(s) : Schmutz J , McClean PE , Mamidi S , Wu GA , Cannon SB , Grimwood J , Jenkins J , Shu S , Song Q , Chavarro C , Torres-Torres M , Geffroy V , Moghaddam SM , Gao D , Abernathy B , Barry K , Blair M , Brick MA , Chovatia M , Gepts P , Goodstein DM , Gonzales M , Hellsten U , Hyten DL , Jia G , Kelly JD , Kudrna D , Lee R , Richard MM , Miklas PN , Osorno JM , Rodrigues J , Thareau V , Urrea CA , Wang M , Yu Y , Zhang M , Wing RA , Cregan PB , Rokhsar DS , Jackson SA
Ref : Nat Genet , 46 :707 , 2014
Abstract : Schmutz_2014_Nat.Genet_46_707
ESTHER : Schmutz_2014_Nat.Genet_46_707
PubMedSearch : Schmutz_2014_Nat.Genet_46_707
PubMedID: 24908249
Gene_locus related to this paper: phavu-v7azs2 , phavu-v7awu7 , phavu-v7bpt6 , phavu-v7b6k3 , phavu-v7cry4