phavu-v7awu7

Phaseolus vulgaris (Kidney bean) (French bean). Uncharacterized protein

Comment

Relationship

Family : Plant_lipase_EDS1-like

Block : L

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MALRGEVIEKAYYAVSWRAHRSPDRPYLIEKISRNGTSEV
IISFPGSGAV RDWYSQRNFGETKIDLNLFPSLKSIGNDE
PALVNEFFSKRFQDILLDRSS LADKVKEAMDKKKQIVFA
GHSSGGPMAILATLWTLEKYPPNSHGGITPLC ITFGSPL
IGNHIFSHATRRENWSSYFFHYVMRYDIVPRILFAPLSSL
DQS FEQISQSFNPRSKSFMSESVGRSSATSDFYFTIISN
AATVTSHAASKLMG TTNTTLETLENFIPLSPYRPFGTYF
FCTGNGKKIMITNPNAVLQVLFFSA QLSTEAETTQVAYR
SLSEHTIYGTELQQIAAQNVLHLDQQHLQNLALSED DAG
GSNDLGLSLRARLCLRAAAELEARKCENEKKLNEKRSFIE
QKLKKDL GEYREMWKHQKVGFYDGFREHKKAEDFKANVT
RLEIAGVWDEIIEKLRSY ELPDEFEAKKEWIKLGTECRE
LVEPLDIANYYRHGRHYEDDASSYMVKGR PKRYRYPQRW
LEHSQRRPQQPTSTSCFWAEVEELRYKTGNSDASYRDVEE
RIVQLVAQIEEWSKNGELAKDVFLEGSTLVKWLKTLHPP
HKQQPFIRSII GE

References

Title : A reference genome for common bean and genome-wide analysis of dual domestications - Schmutz_2014_Nat.Genet_46_707
Author(s) : Schmutz J , McClean PE , Mamidi S , Wu GA , Cannon SB , Grimwood J , Jenkins J , Shu S , Song Q , Chavarro C , Torres-Torres M , Geffroy V , Moghaddam SM , Gao D , Abernathy B , Barry K , Blair M , Brick MA , Chovatia M , Gepts P , Goodstein DM , Gonzales M , Hellsten U , Hyten DL , Jia G , Kelly JD , Kudrna D , Lee R , Richard MM , Miklas PN , Osorno JM , Rodrigues J , Thareau V , Urrea CA , Wang M , Yu Y , Zhang M , Wing RA , Cregan PB , Rokhsar DS , Jackson SA
Ref : Nat Genet , 46 :707 , 2014
Abstract : Schmutz_2014_Nat.Genet_46_707
ESTHER : Schmutz_2014_Nat.Genet_46_707
PubMedSearch : Schmutz_2014_Nat.Genet_46_707
PubMedID: 24908249
Gene_locus related to this paper: phavu-v7azs2 , phavu-v7awu7 , phavu-v7bpt6 , phavu-v7b6k3 , phavu-v7cry4