phavu-v7azs2

Phaseolus vulgaris (Kidney bean) (French bean). Uncharacterized protein

Comment

Relationship

Family : Plant_lipase_EDS1-like

Block : L

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAGGSLGDNIGLKEDVIKRVCGLAFKAHKHKPQEKLYFYE
KVQISSGTYH VFSFSGSWDATEWFVNKPFGGTKIDINLF
PSLRSIGNDEAALVNEGFAKR FDHIFRTTPFKSEVNKAI
GDGKQVVFTGHSSGAAMAIFATFWALEEYLNP TKTQKPK
PPFCVTFGSPLIGNHILSHASRREKWSRYFIHFVLRYDIV
PRI LLAPLSSIHLTFGSILQSLNPKSKTSTQDSTRAEFF
STVMRNTASVTSHA ACILMGSTKLLLETVANFVDLSPYR
PFGTYIFCNGNGQLIVVKNSDAVLQ LLFHTAQLSDLKDL
PEIANDSILQHLSYEAELECSLGMQNVVYLEQLEQL PLS
SDGSDSDVATISTALNGLGLSIRARLCLRAAGELEKQKQK
NEEKISK EFEDKGVASMRYLEKYKTTCEVQKGKGYYDAF
KVQKEENDFQANVKRLVL AGVWDEVIEMLKRYELPDEFE
GKSEWIQHGTIFRRLVEPLDISNYHRHLK NEDTGPYMIW
GRPKRYKYTQRWLEHAKRVPKPVPITESTFWAEVEELHSW
INSKKSFDEVRQRVEQLESDLKKWTHAKELTKDTFSKDP
TFIKFWEILPP ENKANIAALVANVKGL

References

Title : A reference genome for common bean and genome-wide analysis of dual domestications - Schmutz_2014_Nat.Genet_46_707
Author(s) : Schmutz J , McClean PE , Mamidi S , Wu GA , Cannon SB , Grimwood J , Jenkins J , Shu S , Song Q , Chavarro C , Torres-Torres M , Geffroy V , Moghaddam SM , Gao D , Abernathy B , Barry K , Blair M , Brick MA , Chovatia M , Gepts P , Goodstein DM , Gonzales M , Hellsten U , Hyten DL , Jia G , Kelly JD , Kudrna D , Lee R , Richard MM , Miklas PN , Osorno JM , Rodrigues J , Thareau V , Urrea CA , Wang M , Yu Y , Zhang M , Wing RA , Cregan PB , Rokhsar DS , Jackson SA
Ref : Nat Genet , 46 :707 , 2014
Abstract : Schmutz_2014_Nat.Genet_46_707
ESTHER : Schmutz_2014_Nat.Genet_46_707
PubMedSearch : Schmutz_2014_Nat.Genet_46_707
PubMedID: 24908249
Gene_locus related to this paper: phavu-v7azs2 , phavu-v7awu7 , phavu-v7bpt6 , phavu-v7b6k3 , phavu-v7cry4