Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9agar-a0a067tfq4

Galerina marginata CBS 339.88. Uncharacterized protein

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Galerina marginata CBS 339.88
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetidae: N E > Agaricales: N E > Strophariaceae: N E > Galerina: N E > Galerina marginata: N E > Galerina marginata CBS 339.88: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KL142374
1 UniProt : A0A067TFQ4
1 UniProt : A0A067TFQ4
1 Interpro : A0A067TFQ4
1 Pfam : A0A067TFQ4
1 PIRSF : A0A067TFQ4
1 SUPERFAM : A0A067TFQ4
Sequence
Graphical view for this peptide sequence: 9agar-a0a067tfq4
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MKLTHSFASLTLAVFLSLVAQTVATPAAAPLVNLGYAQYQGVTVQDKVTN
ATHTQFLGMRYAAPPTGSRRFSAPAAPATTSGVQLANAEPSTCLQAAQGV
APTTPFRVGPSVHTRDVEASEDCLFLNVYVPGNLGQKKNLPVVFWIHGGG
YVAGSATGADGNDLIRDSGEGVIAVVIQYRLGLFGFLPGQKVKDGGSLNA
GLLDQQFALKWVQTHISKFGGDPLKVTIWGESAGAGSVLQHIIANGGKTT
PPLFRAAITSSTFLPSQYKFNDRIPEMLYSETVAQTNCTSAADTLNCLRN
VDVATIQNANTVINKSGFFGTFVFVPVVDGTFITDRPTQLLKEKKVNGQI
VYSVTNTFEGINFLNASTAATLQVPTYVSQLFPNFGNNEVQAAVAQYANA
GLGSNFNQAVGIMGESIFICPTYYLLRAFGGLAFKGVFAVPPGRHGGDVA
YYFTKYVNFTPPFADPGFDKAFGESFLDFAMALNTNVKWDSANPTPLWPS
FNVSNEMLFNKTAAGASDVRAIKTPSALLARCE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLTHSFASLTLAVFLSLVAQTVATPAAAPLVNLGYAQYQGVTVQDKVTN
ATHTQFLGMRYAAPPTGSRRFSAPAAPATTSGVQLANAEPSTCLQAAQGV
APTTPFRVGPSVHTRDVEASEDCLFLNVYVPGNLGQKKNLPVVFWIHGGG
YVAGSATGADGNDLIRDSGEGVIAVVIQYRLGLFGFLPGQKVKDGGSLNA
GLLDQQFALKWVQTHISKFGGDPLKVTIWGESAGAGSVLQHIIANGGKTT
PPLFRAAITSSTFLPSQYKFNDRIPEMLYSETVAQTNCTSAADTLNCLRN
VDVATIQNANTVINKSGFFGTFVFVPVVDGTFITDRPTQLLKEKKVNGQI
VYSVTNTFEGINFLNASTAATLQVPTYVSQLFPNFGNNEVQAAVAQYANA
GLGSNFNQAVGIMGESIFICPTYYLLRAFGGLAFKGVFAVPPGRHGGDVA
YYFTKYVNFTPPFADPGFDKAFGESFLDFAMALNTNVKWDSANPTPLWPS
FNVSNEMLFNKTAAGASDVRAIKTPSALLARCE


Reference
    Title: Extensive sampling of basidiomycete genomes demonstrates inadequacy of the white-rot/brown-rot paradigm for wood decay fungi
    Riley R, Salamov AA, Brown DW, Nagy LG, Floudas D, Held BW, Levasseur A, Lombard V, Morin E and Grigoriev IV <15 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 111:9923, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer