Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-a0u8m3

Burkholderia cenocepacia, Pseudomonas pyrrocinia, Mumia flava, Burkholderia sp. alpha/beta hydrolase fold

Comment
Other strains: Burkholderia cenocepacia (MC0-3; AU 1054; HI2424; CGD2; CF2; H111; KC-01; PC184; ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610; BC7) (Burkholderia cepacia (J2315; LMG 16656 NP88))), Pseudomonas pyrrocinia, Mumia flava, Burkholderia sp. TJI49 alpha/beta hydrolase fold


Relationship
Family|NFM-deformylase
Block| X
Position in NCBI Life Tree|Burkholderia cenocepacia
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia cepacia complex: N E > Burkholderia cenocepacia: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 24 more: AAVA01000024, AAHI01000032, AAHL01000104
>3 UniProt links 6 more: A0A071ML55, B9BJE6, J4RY92
>3 UniProt links 6 more: A0A071ML55, B9BJE6, J4RY92
>3 Interpro links 6 more: A0A071ML55, B9BJE6, J4RY92
>3 Prodom links 6 more: A0A071ML55, B9BJE6, J4RY92
>3 Pfam links 6 more: A0A071ML55, B9BJE6, J4RY92
>3 PIRSF links 6 more: A0A071ML55, B9BJE6, J4RY92
>3 SUPERFAM links 6 more: A0A071ML55, B9BJE6, J4RY92
Sequence
Graphical view for this peptide sequence: 9burk-a0u8m3
Colored MSA for NFM-deformylase (raw)
MSSTFLYGANVRANGIRQHYLRYGGATGARASRPAIVLIPGITSPAITWG
FVGEVFGAAFDTYVLDVRGRGLSDASPSLDYSLDAQADDVASLVAALDLP
RMSLVGHSMGARIAARAARRGIRGLASVVLVDPPVSGPNRRDYPGKLPWY
IDSMALARAGTDADGMRAFCPTWTDAELRLRAEWLHTCDERAVRASYEGF
HTDDFHADAAQLAVPSLLITAERGDVVRDDDVAELQRATPTMRHVRVPDA
GHMIPWDNAAGFYAAFGDFLGAPLAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSSTFLYGANVRANGIRQHYLRYGGATGARASRPAIVLIPGITSPAITWG
FVGEVFGAAFDTYVLDVRGRGLSDASPSLDYSLDAQADDVASLVAALDLP
RMSLVGHSMGARIAARAARRGIRGLASVVLVDPPVSGPNRRDYPGKLPWY
IDSMALARAGTDADGMRAFCPTWTDAELRLRAEWLHTCDERAVRASYEGF
HTDDFHADAAQLAVPSLLITAERGDVVRDDDVAELQRATPTMRHVRVPDA
GHMIPWDNAAGFYAAFGDFLGAPLAA


References
1 more
    Title: Genome characterization of a novel Burkholderia cepacia complex genomovar isolated from dieback affected mango orchards
    Khan A, Asif H, Studholme DJ, Khan IA, Azim MK
    Ref: World J Microbiol Biotechnol, 29:2033, 2013 : PubMed

            

    Title: Draft genome sequence determination for cystic fibrosis and chronic granulomatous disease Burkholderia multivorans isolates
    Varga JJ, Losada L, Zelazny AM, Brinkac L, Harkins D, Radune D, Hostetler J, Sampaio EP, Ronning CM and Goldberg JB <3 more author(s)>
    Ref: Journal of Bacteriology, 194:6356, 2012 : PubMed

            

    Title: The genome of Burkholderia cenocepacia J2315, an epidemic pathogen of cystic fibrosis patients
    Holden MT, Seth-Smith HM, Crossman LC, Sebaihia M, Bentley SD, Cerdeno-Tarraga AM, Thomson NR, Bason N, Quail MA and Parkhill J <22 more author(s)>
    Ref: Journal of Bacteriology, 191:261, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer