Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9flao-a0a0c1f4u8

Kaistella jeonii Poly(Ethylene terephthalate) hydrolase PET30 PET30 PorC

Comment
c-term 300 365 Por_Secre_tail excluded here


Relationship
Family|Polyesterase-lipase-cutinase
Block| L
Position in NCBI Life Tree|Kaistella jeonii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Flavobacteriia: N E > Flavobacteriales: N E > Weeksellaceae: N E > Chryseobacterium group: N E > Chryseobacterium jeonii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
7PZJ: Structure of a bacteroidetal polyethylene terephthalate (PET) esterase PET30 PET30PorC
No kinetic





6 substrates (e.g. : BHET, Impranil, Paranitrophenyl-hexanoate... more)
No inhibitor
2 Genbank : WP_039353427, KIA88187
1 UniProt : A0A0C1F4U8
1 Structure : 7PZJ
1 UniProt : A0A0C1F4U8
1 Interpro : A0A0C1F4U8
1 Pfam : A0A0C1F4U8
1 PIRSF : A0A0C1F4U8
1 SUPERFAM : A0A0C1F4U8
Sequence
Graphical view for this peptide sequence: 9flao-a0a0c1f4u8
Colored MSA for Polyesterase-lipase-cutinase (raw)
MRKLYLFLFLTLISPISISIFHAQCTGATVESLTNPGPYTVATLSEADGV
RNGPKYAGSTIYYPTNATPPYASIAIVPGFTAAPSSVQEWGPFYASHGIV
AIIIGTNSLYDQPEARALALLDALETIKQENGRATSPLIGKLDVTKLAVS
GWSMGGGGAQRAAVLDNTISAVVALCPYLTSPQLNHTVPVLIFSGQSDPT
APPSQHANVHYNTTPGTTNKLLFEVKNGNHSVANSPTGGGGAVGKLALSW
LKIYLEKNDCYCSVLATAIVNSTTVSSKISQSYQCNNALGVVDSKTRFNL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRKLYLFLFLTLISPISISIFHAQCTGATVESLTNPGPYTVATLSEADGV
RNGPKYAGSTIYYPTNATPPYASIAIVPGFTAAPSSVQEWGPFYASHGIV
AIIIGTNSLYDQPEARALALLDALETIKQENGRATSPLIGKLDVTKLAVS
GWSMGGGGAQRAAVLDNTISAVVALCPYLTSPQLNHTVPVLIFSGQSDPT
APPSQHANVHYNTTPGTTNKLLFEVKNGNHSVANSPTGGGGAVGKLALSW
LKIYLEKNDCYCSVLATAIVNSTTVSSKISQSYQCNNALGVVDSKTRFNL


References
    Title: The Bacteroidetes Aequorivita sp. and Kaistella jeonii Produce Promiscuous Esterases With PET-Hydrolyzing Activity
    Zhang H, Perez-Garcia P, Dierkes RF, Applegate V, Schumacher J, Chibani CM, Sternagel S, Preuss L, Weigert S and Streit WR <9 more author(s)>
    Ref: Front Microbiol, 12:803896, 2021 : PubMed

            

    Title: The abundance of mRNA transcripts of bacteroidetal polyethylene terephthalate (PET) esterase genes may indicate a role in marine plastic degradation
    Zhang H, Dierkes R, Perez-Garcia P, Weigert S, Sternagel S, Hallam S, Schott T, Juergens K, Vollstedt C and Streit WR <8 more author(s)>
    Ref: ResearchSquare, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer