Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: alceu-catD1

Ralstonia eutropha; Ralstonia sp.; Cupriavidus necator; Cupriavidus sp., 3-oxoadipate enol-lactone hydrolase (catD1) gene (EC 3.1.1.24)

Comment
Other strains: Ralstonia eutropha; Ralstonia sp. GA3-3; Cupriavidus necator (ATCC 17699 / H16 / DSM 428 / Stanier 337; ATCC 43291 / DSM 13513 / N-1); Cupriavidus sp. SK-4


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Ralstonia eutropha
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Cupriavidus: N E > Cupriavidus necator: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AF042281, AM260479, CP002877
>3 UniProt links 1 more: Q0KAA2, G0EXS1, R7XIV9
1 Ncbi-nid : 11967275
1 Ncbi-pid : 11967281
>3 UniProt links 2 more: Q9EV40, Q0KAA2, G0EXS1
>3 Interpro links 2 more: Q9EV40, Q0KAA2, G0EXS1
>3 Pfam links 2 more: Q9EV40, Q0KAA2, G0EXS1
>3 PIRSF links 2 more: Q9EV40, Q0KAA2, G0EXS1
>3 SUPERFAM links 2 more: Q9EV40, Q0KAA2, G0EXS1
Sequence
Graphical view for this peptide sequence: alceu-catD1
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MRFATRDGLRLHYELNGPAGAPVLALSNSLGTTLSMWDPQMPALLERFRV
LRYDTRGHGASGVPAAPFGMAELGADVLAVMDHAGVEHAHFCGLSMGGMT
GIWLARHHPERFGRFVLANTAALIGPASGWNTRIERVSNEGMAAIAGGVL
ARWFTPAALAGDPAHIAPVLAMLASTDADGYIANCAAVRDADLRGLLPGI
RSRVLVIAGVQDAATTPEQGRELAQGIAGAEYLALNAAHLSNWELPEAFS
HAVIHFLSQA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRFATRDGLRLHYELNGPAGAPVLALSNSLGTTLSMWDPQMPALLERFRV
LRYDTRGHGASGVPAAPFGMAELGADVLAVMDHAGVEHAHFCGLSMGGMT
GIWLARHHPERFGRFVLANTAALIGPASGWNTRIERVSNEGMAAIAGGVL
ARWFTPAALAGDPAHIAPVLAMLASTDADGYIANCAAVRDADLRGLLPGI
RSRVLVIAGVQDAATTPEQGRELAQGIAGAEYLALNAAHLSNWELPEAFS
HAVIHFLSQA


References
    Title: Draft Genome Sequence of Ralstonia sp. Strain GA3-3, Isolated from Australian Suburban Soil
    Pearce SL, Pushiri H, Oakeshott JG, Russell RJ, Pandey G
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Complete genome sequence of the type strain Cupriavidus necator N-1
    Poehlein A, Kusian B, Friedrich B, Daniel R, Bowien B
    Ref: Journal of Bacteriology, 193:5017, 2011 : PubMed

            

    Title: Genome sequence of the bioplastic-producing Knallgas bacterium Ralstonia eutropha H16
    Pohlmann A, Fricke WF, Reinecke F, Kusian B, Liesegang H, Cramm R, Eitinger T, Ewering C, Potter M and Bowien B <6 more author(s)>
    Ref: Nat Biotechnol, 24:1257, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer