arath-At2g42450

 
Arabidopsis thaliana At2g42450 MHK10.17

Relationship
Family Lipase_3
Block L
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : AC005956
1 Ncbi-nid : 6598500
1 Ncbi-pid : 4567316
1 UniProtTrembl : Q9SLB5
1 Interpro : Q9SLB5
1 Prodom : Q9SLB5
1 Pfam : Q9SLB5
1 PIRSF : Q9SLB5
1 SUPERFAM : Q9SLB5
1 QuickSwissBlast : Q9SLB5
1 Tair database : AT2G42450
 
Sequence
Graphical view for this peptide sequence: arath-At2g42450
Colored MSA for Lipase_3 (raw)
MNPVVVESSPFRKRSGLYQGVVYNVIKRFQSHLSESGKVEKELEEQEAEK
RRPSSVTSSRSGLEKRRQFESGIDNDSSSDEDTGEKSLPGSRSLSEIIAS
IQRSRLGIEGWTFGDLTIGLYLIYLRQASLSPFEDVKGVEVVSESTVYDL
IYNAELAKGCYRDSVSGLAKNTMLRENNILKFVKDSSVMRPGYYIGVDHR
RKLVVFGIRGTHTIYDLITDIVSSSDEEVTFEGYSTHFGTAEAARWFLNH
ELQTIRRCLAKYEGYKLRLVGHSLGGAIASLMAIMLKKMPREELGFDAEI
ISAVGYATPPCVSKELAENCSEFVTTIVMQDDIIPRLSAASLARLRNEIL
QTDWTSVIEKEEWKNVLDLVTNAKQVVTSVQDVARKVSDYANFGNKKEVP
EIPSSKNNQSGILISDSTTKDVVKLPEELYVPGAVYYLMRSLRGTPKSSA
GKQVEYYSLWKRDPGQHFQRILLSGNFITDHKCDSHYYALRDVLKGFPSF
INESIFKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNPVVVESSPFRKRSGLYQGVVYNVIKRFQSHLSESGKVEKELEEQEAEK
RRPSSVTSSRSGLEKRRQFESGIDNDSSSDEDTGEKSLPGSRSLSEIIAS
IQRSRLGIEGWTFGDLTIGLYLIYLRQASLSPFEDVKGVEVVSESTVYDL
IYNAELAKGCYRDSVSGLAKNTMLRENNILKFVKDSSVMRPGYYIGVDHR
RKLVVFGIRGTHTIYDLITDIVSSSDEEVTFEGYSTHFGTAEAARWFLNH
ELQTIRRCLAKYEGYKLRLVGHSLGGAIASLMAIMLKKMPREELGFDAEI
ISAVGYATPPCVSKELAENCSEFVTTIVMQDDIIPRLSAASLARLRNEIL
QTDWTSVIEKEEWKNVLDLVTNAKQVVTSVQDVARKVSDYANFGNKKEVP
EIPSSKNNQSGILISDSTTKDVVKLPEELYVPGAVYYLMRSLRGTPKSSA
GKQVEYYSLWKRDPGQHFQRILLSGNFITDHKCDSHYYALRDVLKGFPSF
INESIFKK

Graphical view for this nucleotide DNA sequence (2711 bp): arath-At2g42450



Reference
    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer