arath-MES1

 
Arabidopsis thaliana Methylesterase 1, AtMES1 AT2G23620 F26B6.27 putative acetone-cyanohydrin lyase

Comment
Methylesterase shown to have carboxylesterase activity, methyl indole-3-acetic acid (MeIAA) esterase activity, methyl salicylate (MeSA) esterase activity and methyl jasmonate (MeJA) esterase activity in vitro. Required to convert methyl salicylate (MeSA) to salicylic acid (SA) as part of the signal transduction pathways that activate systemic acquired resistance in systemic tissue. MeSA is believed to be an inactive form that needs to be demethylated to exert a biological effect.


Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E

Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: Methyl-salicylate ,

3 Genbank : AC004482, AAO22676, BT002859
1 UniProt : Q8S8S9
2 Ncbi-nid : 6598420, 27754456
2 Ncbi-pid : 6598421, 27754457
1 UniProtTrembl : Q8S8S9
1 Interpro : Q8S8S9
1 Prodom : Q8S8S9
1 Pfam : Q8S8S9
1 PIRSF : Q8S8S9
1 SUPERFAM : Q8S8S9
1 QuickSwissBlast : Q8S8S9
1 Tair database : At2g23620
 
Sequence
Graphical view for this peptide sequence: arath-MES1
Colored MSA for Hydroxynitrile_lyase (raw)
MSEEKRKQHFVLVHGSCHGAWCWYKVKPLLEAVGHRVTAVDLAASGIDTT
RSITDIPTCEQYSEPLTKLLTSLPNDEKVVLVGHSFGGLNLAIAMEKFPE
KISVAVFLTAFMPDTEHSPSFVLDKFGSNMPQEAWMGTEFEPYGSDNSGL
SMFFSPDFMKLGLYQLSPVEDLELGLLLMRPGSLFINDLSKMKNFSDEGY
GSVPRVFIVCKEDKAIPEERQRWMIDNFPVNLVMEMEETDHMPMFCKPQQ
LSDYFLKIADKFV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSEEKRKQHFVLVHGSCHGAWCWYKVKPLLEAVGHRVTAVDLAASGIDTT
RSITDIPTCEQYSEPLTKLLTSLPNDEKVVLVGHSFGGLNLAIAMEKFPE
KISVAVFLTAFMPDTEHSPSFVLDKFGSNMPQEAWMGTEFEPYGSDNSGL
SMFFSPDFMKLGLYQLSPVEDLELGLLLMRPGSLFINDLSKMKNFSDEGY
GSVPRVFIVCKEDKAIPEERQRWMIDNFPVNLVMEMEETDHMPMFCKPQQ
LSDYFLKIADKFV

Graphical view for this nucleotide DNA sequence (1835 bp): arath-MES1



References
    Title: Identification of likely orthologs of tobacco salicylic acid-binding protein 2 and their role in systemic acquired resistance in Arabidopsis thaliana
    Vlot AC, Liu PP, Cameron RK, Park SW, Yang Y, Kumar D, Zhou F, Padukkavidana T, Gustafsson C and Klessig DF <1 more author(s)>
    Ref: Plant J, 56:445, 2008 : PubMed

            

    Title: Inactive methyl indole-3-acetic acid ester can be hydrolyzed and activated by several esterases belonging to the AtMES esterase family of Arabidopsis
    Yang Y, Xu R, Ma CJ, Vlot AC, Klessig DF, Pichersky E
    Ref: Plant Physiol, 147:1034, 2008 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer