Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: artan-a0a2u1n9p7.2

Artemisia annua (Sweet wormwood). Alpha/beta hydrolase domain-containing protein 13

Comment
fragments of a gene concatened with a duplicate. The first considered as a fragment


Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Artemisia annua
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > campanulids: N E > Asterales: N E > Asteraceae: N E > Asteroideae: N E > Anthemideae: N E > Artemisiinae: N E > Artemisia: N E > Artemisia annua: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : PKPP01003286
1 UniProt : A0A2U1N9P7
1 UniProt : A0A2U1N9P7
1 Interpro : A0A2U1N9P7
1 Prodom : A0A2U1N9P7
1 Pfam : A0A2U1N9P7
1 PIRSF : A0A2U1N9P7
1 SUPERFAM : A0A2U1N9P7
Sequence
Graphical view for this peptide sequence: artan-a0a2u1n9p7.2
Colored MSA for ABHD13-BEM46 (raw)
GGIVVTGMALLVAFQEKLVYVPVLPGLTKSYPITPARLRLIFDDVWLTSS
DGLRLHSWFIKYSHDCRGPTILFLQENAGNIAHRLEMARIMLQNLHCNIF
MLSYRGYGASDGYPSQQGLIRDAQAAVDHLSQRTDIDTSQIVVFGRSLGG
AVGAAVTKNNPDKVAALILENTFTSILDMAGVLLPFLKYFIGGSLSKGPK
ILNFVVRSPWNTLDIVGQVKQPILFLSGERDEMIPPLHMQMLYAKAAAHN
KRCTFVEFPTGMHMDTWIAGGDHYWKTVQTFLQQTLNEKKADESHPEGND
SVTL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GGIVVTGMALLVAFQEKLVYVPVLPGLTKSYPITPARLRLIFDDVWLTSS
DGLRLHSWFIKYSHDCRGPTILFLQENAGNIAHRLEMARIMLQNLHCNIF
MLSYRGYGASDGYPSQQGLIRDAQAAVDHLSQRTDIDTSQIVVFGRSLGG
AVGAAVTKNNPDKVAALILENTFTSILDMAGVLLPFLKYFIGGSLSKGPK
ILNFVVRSPWNTLDIVGQVKQPILFLSGERDEMIPPLHMQMLYAKAAAHN
KRCTFVEFPTGMHMDTWIAGGDHYWKTVQTFLQQTLNEKKADESHPEGND
SVTL


Reference
    Title: The Genome of Artemisia annua Provides Insight into the Evolution of Asteraceae Family and Artemisinin Biosynthesis
    Shen Q, Zhang L, Liao Z, Wang S, Yan T, Shi P, Liu M, Fu X, Pan Q and Tang K <15 more author(s)>
    Ref: Mol Plant, 11:776, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer