Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacwk-a9vju9

Bacillus weihenstephanensis (strain KBAB4) Bacillus mycoides DSM 2048 Bacillus cereus (AH603; BDRD-ST196; AH621) Putative esterase

Relationship
Family|A85-IroE-IroD-Fes-Yiel
Block| X
Position in NCBI Life Tree|Bacillus weihenstephanensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus mycoides: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: CP000903, ACMU01000029, ACMP01000043
>3 UniProt links 1 more: A9VJU9, C2XQX5, C2SGX3
>3 UniProt links 1 more: A9VJU9, C2XQX5, C2SGX3
>3 Interpro links 1 more: A9VJU9, C2XQX5, C2SGX3
>3 Prodom links 1 more: A9VJU9, C2XQX5, C2SGX3
>3 Pfam links 1 more: A9VJU9, C2XQX5, C2SGX3
>3 PIRSF links 1 more: A9VJU9, C2XQX5, C2SGX3
>3 SUPERFAM links 1 more: A9VJU9, C2XQX5, C2SGX3
Sequence
Graphical view for this peptide sequence: bacwk-a9vju9
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MNQTIGRIEEISFFSTSLQEELTLLVYLPVNYTPLHKHTVVIAQDGRDYF
QLGKAHRVIERLRETEEIDRTIIVGIPYKNVHDRKEKYFPNDVKNAAYIR
FLAHELAPYIDANYPTYQMGKGRVLIGDSLGGTVSFMTALMYPHTFGKIV
MQSPFVDETVMNLAKDFKNPGALDLYHVIGTEETAVKRTDGQVSDFVEPN
RELNKLLTDRNFITHYEEFEGNHTWKYWQADLPKAFSHILSMK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNQTIGRIEEISFFSTSLQEELTLLVYLPVNYTPLHKHTVVIAQDGRDYF
QLGKAHRVIERLRETEEIDRTIIVGIPYKNVHDRKEKYFPNDVKNAAYIR
FLAHELAPYIDANYPTYQMGKGRVLIGDSLGGTVSFMTALMYPHTFGKIV
MQSPFVDETVMNLAKDFKNPGALDLYHVIGTEETAVKRTDGQVSDFVEPN
RELNKLLTDRNFITHYEEFEGNHTWKYWQADLPKAFSHILSMK


Reference
    Title: Extending the Bacillus cereus group genomics to putative food-borne pathogens of different toxicity
    Lapidus A, Goltsman E, Auger S, Galleron N, Segurens B, Dossat C, Land ML, Broussolle V, Brillard J and Sorokin A <8 more author(s)>
    Ref: Chemico-Biological Interactions, 171:236, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer