Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bovin-LIPG

Bos taurus; Bos mutus (wild yak) lipase G, endothelial type (LIPG)

Comment
Other strains: Bos taurus; Bos mutus (wild yak)


Relationship
Family|Lipoprotein_Lipase
Block| L
Position in NCBI Life Tree|Bos taurus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Ruminantia: N E > Pecora: N E > Bovidae: N E > Bovinae: N E > Bos: N E > Bos taurus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: XM_002697766, XP_002697812, JH880264
1 UniProt : L8J6A1
1 UniProt : L8J6A1
1 Interpro : L8J6A1
1 Prodom : L8J6A1
1 Pfam : L8J6A1
1 PIRSF : L8J6A1
1 SUPERFAM : L8J6A1
Sequence
Graphical view for this peptide sequence: bovin-LIPG
Colored MSA for Lipoprotein_Lipase (raw)
MRNTVLQLCLWSAYCGFATGDPTPLGPEGRLQGEFDKSRVVPTAAKPPVR
FNLRTSEDPEDEGCDLSLGHSQPLEDCGFNVTAKTFFIIHGWTMSGMFEN
WLYKLVSALQTREKGANVVVVDWLPLAHQLYVDAVNNTRGVGHSIAQMLD
WLQGKEDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPLFE
GADVHRRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQP
GCGLNDVLGSIAYGTIAEVLKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKTRNKRNSKMYLKTRAGMPFRVYHYQ
MKIHVFSYKNMGEMEPTFYVTLYGTNADSQVLSLEMVEQIGLNATNTFLV
YTEEDLGDLLKIKLTWEGKSQSWYNLWKELRSYLTQSRGSKQELHIRRIR
VKSGETQRRLTFCAEDLENTLISPGQELWFHKCLDGWRMKNQTSPTVEHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRNTVLQLCLWSAYCGFATGDPTPLGPEGRLQGEFDKSRVVPTAAKPPVR
FNLRTSEDPEDEGCDLSLGHSQPLEDCGFNVTAKTFFIIHGWTMSGMFEN
WLYKLVSALQTREKGANVVVVDWLPLAHQLYVDAVNNTRGVGHSIAQMLD
WLQGKEDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPLFE
GADVHRRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQP
GCGLNDVLGSIAYGTIAEVLKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKTRNKRNSKMYLKTRAGMPFRVYHYQ
MKIHVFSYKNMGEMEPTFYVTLYGTNADSQVLSLEMVEQIGLNATNTFLV
YTEEDLGDLLKIKLTWEGKSQSWYNLWKELRSYLTQSRGSKQELHIRRIR
VKSGETQRRLTFCAEDLENTLISPGQELWFHKCLDGWRMKNQTSPTVEHL


Reference
    Title: The yak genome and adaptation to life at high altitude
    Qiu Q, Zhang G, Ma T, Qian W, Wang J, Ye Z, Cao C, Hu Q, Kim J and Liu J <35 more author(s)>
    Ref: Nat Genet, 44:946, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer