Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: burce-a0a088tsj6

Burkholderia cepacia (Pseudomonas cepacia); Burkholderia cepacia; Burkholderia sp.; Burkholderia lata; Mumia flava. Alpha/beta hydrolase fold family protein

Comment
Other strains: Burkholderia cepacia (ATCC 25416; J2315); Burkholderia sp. (AU4i; MSh2); Burkholderia cenocepacia (BC7; ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610; H111; HI2424; MC0-3; PC184; KC-01); Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383); Mumia flava


Relationship
Family|CarbLipBact_2
Block| X
Position in NCBI Life Tree|Burkholderia cepacia
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia cepacia complex: N E > Burkholderia cepacia: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: burce-a0a088tsj6
Colored MSA for CarbLipBact_2 (raw)
MTGRTGVLLIHGLGGTQYDLGSLHKAVRRAGGDTHMITLPGHGTRPEDLV
GVRAEAWLDAVTEQYRALENEYDTVHVAGMCMGALVALLLCHRVQHARGR
LALLATPMFIDGWSTPWYRALRHVLYRVPGVAERMRVEEGDPFGIKNATI
RAIVKKKFEREDSFHYAWVPLACVRQVDRMRDWALEAAAGTPCATLVLHA
REDELTSLRSADFLLAKMPDARGIVLENSYHMICADNDRDDVARHVLEFF
GFDPVHAVSPAMARRMGRMAP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTGRTGVLLIHGLGGTQYDLGSLHKAVRRAGGDTHMITLPGHGTRPEDLV
GVRAEAWLDAVTEQYRALENEYDTVHVAGMCMGALVALLLCHRVQHARGR
LALLATPMFIDGWSTPWYRALRHVLYRVPGVAERMRVEEGDPFGIKNATI
RAIVKKKFEREDSFHYAWVPLACVRQVDRMRDWALEAAAGTPCATLVLHA
REDELTSLRSADFLLAKMPDARGIVLENSYHMICADNDRDDVARHVLEFF
GFDPVHAVSPAMARRMGRMAP


References
    Title: Draft Genome Sequences of Burkholderia cenocepacia ET12 Lineage Strains K56-2 and BC7
    Varga JJ, Losada L, Zelazny AM, Kim M, McCorrison J, Brinkac L, Sampaio EP, Greenberg DE, Singh I and Goldberg JB <4 more author(s)>
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: The genome of Burkholderia cenocepacia J2315, an epidemic pathogen of cystic fibrosis patients
    Holden MT, Seth-Smith HM, Crossman LC, Sebaihia M, Bentley SD, Cerdeno-Tarraga AM, Thomson NR, Bason N, Quail MA and Parkhill J <22 more author(s)>
    Ref: Journal of Bacteriology, 191:261, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer