Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: erecy-g8jrp5

Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) (Yeast). Uncharacterized protein

Relationship
Family|Arb2_domain
Block| X
Position in NCBI Life Tree|Eremothecium cymbalariae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Eremothecium: N E > Eremothecium cymbalariae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP002499, XP_003645631.1
1 UniProt : G8JRP5
1 UniProt : G8JRP5
1 Interpro : G8JRP5
1 Pfam : G8JRP5
1 PIRSF : G8JRP5
1 SUPERFAM : G8JRP5
Sequence
Graphical view for this peptide sequence: erecy-g8jrp5
Colored MSA for Arb2_domain (raw)
PLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTLIIC
VHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQ
SLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHL
LGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHS
CWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWS
DSE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

PLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTLIIC
VHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQ
SLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHL
LGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHS
CWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWS
DSE


Reference
    Title: Pichia sorbitophila, an Interspecies Yeast Hybrid, Reveals Early Steps of Genome Resolution After Polyploidization
    Louis VL, Despons L, Friedrich A, Martin T, Durrens P, Casaregola S, Neuveglise C, Fairhead C, Marck C and Souciet JL <33 more author(s)>
    Ref: G3 (Bethesda), 2:299, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer