Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: fratt-q5nga8

Francisella tularensis (subsp. tularensis, holarctica, novicida, mediasiatica), Francisella novicida, pimeloyl-ACP methyl ester esterase BioJ

Comment
The FTN_0818 gene required for Francisella virulence is involved in biotin metabolism. This protein named BioJ is the enzyme of the biotin biosynthesis pathway that determines the chain length of the biotin valeryl side-chain. It is the functionnal equivalent of BioH although it shows low homology to BioH. Other strains: Francisella tularensis (subsp. tularensis (SCHU S4 / Schu 4; MA00-2987; WY96-3418; NE061598; FSC033; FSC 198), holarctica (LVS; FSC022; FTNF002-00 / FTA; 257; OSU18), novicida (U112), mediasiatica (FSC147)), Francisella novicida (FTG; GA99-3548; FTE; GA99-3549)


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Francisella tularensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Thiotrichales: N E > Francisellaceae: N E > Francisella: N E > Francisella tularensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: fratt-q5nga8
Colored MSA for Hormone-sensitive_lipase_like (raw)
MPYNPSLEALLDTPEIRRIKKLDLTQQREIFTSLSVEQLKRLPRPDILEE
DIKLENNTILRHYQPKKSSNKAVLFIHGGGWCLGSINTYDHVCRYLCDQG
NLNIFSLEYGLAPEQKYPAAVDHALYAYDWLYQNINKFKISAENIFVMGD
SAGGNLVTIVCHERQENMPKAQILVYPAVDMYTKYDSNKKFDENKYHLTT
EWCELFLKAYIGEDVMSEPKKLRHPTISPLFYKDTKQPDTLIVAATHDIL
IDGIYAYEEKLKQQGTYVETYYDDEMFHGFMGILGITPFENPKIALNKVI
EFINKR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPYNPSLEALLDTPEIRRIKKLDLTQQREIFTSLSVEQLKRLPRPDILEE
DIKLENNTILRHYQPKKSSNKAVLFIHGGGWCLGSINTYDHVCRYLCDQG
NLNIFSLEYGLAPEQKYPAAVDHALYAYDWLYQNINKFKISAENIFVMGD
SAGGNLVTIVCHERQENMPKAQILVYPAVDMYTKYDSNKKFDENKYHLTT
EWCELFLKAYIGEDVMSEPKKLRHPTISPLFYKDTKQPDTLIVAATHDIL
IDGIYAYEEKLKQQGTYVETYYDDEMFHGFMGILGITPFENPKIALNKVI
EFINKR


References
2 more
    Title: Expression and Activity of the BioH Esterase of Biotin Synthesis is Independent of Genome Context
    Cao X, Zhu L, Hu Z, Cronan JE
    Ref: Sci Rep, 7:2141, 2017 : PubMed

            

    Title: A Francisella virulence factor catalyses an essential reaction of biotin synthesis
    Feng Y, Napier BA, Manandhar M, Henke SK, Weiss DS, Cronan JE
    Ref: Molecular Microbiology, 91:300, 2014 : PubMed

            

    Title: The complete genome sequence of Francisella tularensis, the causative agent of tularemia
    Larsson P, Oyston PC, Chain P, Chu MC, Duffield M, Fuxelius HH, Garcia E, Halltorp G, Johansson D and Titball RW <17 more author(s)>
    Ref: Nat Genet, 37:153, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer