Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: haein-y1552

Haemophilus influenzae pimeloyl-ACP methyl esterase BioG

Comment
Other strains: Haemophilus influenzae. (and strains HK1212; 6P18H1; PittHH; RdAW; 7P49H1; PittEE) Dithiobiotin synthetase hypothetical protein hi1552


Relationship
Family|Duf_452
Block| X
Position in NCBI Life Tree|Haemophilus influenzae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pasteurellales: N E > Pasteurellaceae: N E > Haemophilus: N E > Haemophilus influenzae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 5GNG, 5H3B
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: L42023, ABFC01000200, ABWW01000001
1 UniProt : P44251
2 Structure : 5GNG, 5H3B
1 UniProt : P44251
1 Interpro : P44251
1 Pfam : P44251
1 PIRSF : P44251
1 SUPERFAM : P44251
Sequence
Graphical view for this peptide sequence: haein-y1552
Colored MSA for Duf_452 (raw)
MKTKFYDYQGEHLILYFAGWGTPPDAVNHLILPENHDLLICYDYQDLNLD
FDLSAYRHIRLVAWSMGVWVAERVLQGIRLKSATAVNGTGLPCDDSFGIP
YAIFKGTLENLTENTRLKFERRICGDKASFERYQLFPARPFDEIHQELTA
LFAMIQQDKRIDLIHWANAWVSSRDKIFTPANQHQYWALRCAVQEIEGEH
YVFSRFTHWSALWDH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKTKFYDYQGEHLILYFAGWGTPPDAVNHLILPENHDLLICYDYQDLNLD
FDLSAYRHIRLVAWSMGVWVAERVLQGIRLKSATAVNGTGLPCDDSFGIP
YAIFKGTLENLTENTRLKFERRICGDKASFERYQLFPARPFDEIHQELTA
LFAMIQQDKRIDLIHWANAWVSSRDKIFTPANQHQYWALRCAVQEIEGEH
YVFSRFTHWSALWDH


References
1 more
    Title: An Atypical alpha/beta-Hydrolase Fold Revealed in the Crystal Structure of Pimeloyl-Acyl Carrier Protein Methyl Esterase BioG from Haemophilus influenzae
    Shi J, Cao X, Chen Y, Cronan JE, Guo Z
    Ref: Biochemistry, 55:6705, 2016 : PubMed

            

    Title: Tracing phylogenomic events leading to diversity of Haemophilus influenzae and the emergence of Brazilian Purpuric Fever (BPF)-associated clones
    Papazisi L, Ratnayake S, Remortel BG, Bock GR, Liang W, Saeed AI, Liu J, Fleischmann RD, Kilian M, Peterson SN
    Ref: Genomics, 96:290, 2010 : PubMed

            

    Title: Whole-genome random sequencing and assembly of Haemophilus influenzae Rd
    Fleischmann RD, Adams MD, White O, Clayton RA, Kirkness EF, Kerlavage AR, Bult CJ, Tomb JF, Dougherty BA and Venter JC <31 more author(s)>
    Ref: Science, 269:496, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer