Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lisw6-a0agy6

Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 complete genome (EC 3.1.-.-)

Relationship
Family|CarbLipBact_2
Block| X
Position in NCBI Life Tree|Listeria welshimeri
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Listeriaceae: N E > Listeria: N E > Listeria welshimeri: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AM263198
1 UniProt : A0AGY6
1 UniProt : A0AGY6
1 Interpro : A0AGY6
1 Pfam : A0AGY6
1 PIRSF : A0AGY6
1 SUPERFAM : A0AGY6
Sequence
Graphical view for this peptide sequence: lisw6-a0agy6
Colored MSA for CarbLipBact_2 (raw)
MVACLCIHGFTGSPSEVKPLADYLREHTDWDVLAPTLPGHDHLRHLKNVT
YKDWIVFVDSILSQMLKEDDEVYIIGFSMGGLLAGWLARHYPEVKKLVLL
DIALNAIERPQVVGNSKQAINEAKEITLKNNPMFKRNQKKATEVSLTFTL
QFEKMVALAKPAFEHIEIPTFIAQENGNPKASTEKSVQFLLESIPGPKEL
FVLEGPKQIISPDEQANKLYPAVLIFLQKDVAILNVN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVACLCIHGFTGSPSEVKPLADYLREHTDWDVLAPTLPGHDHLRHLKNVT
YKDWIVFVDSILSQMLKEDDEVYIIGFSMGGLLAGWLARHYPEVKKLVLL
DIALNAIERPQVVGNSKQAINEAKEITLKNNPMFKRNQKKATEVSLTFTL
QFEKMVALAKPAFEHIEIPTFIAQENGNPKASTEKSVQFLLESIPGPKEL
FVLEGPKQIISPDEQANKLYPAVLIFLQKDVAILNVN


Reference
    Title: Whole-genome sequence of Listeria welshimeri reveals common steps in genome reduction with Listeria innocua as compared to Listeria monocytogenes
    Hain T, Steinweg C, Kuenne CT, Billion A, Ghai R, Chatterjee SS, Domann E, Karst U, Goesmann A and Chakraborty T <12 more author(s)>
    Ref: Journal of Bacteriology, 188:7405, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer