Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: oikdi-e4ya76

Oikopleura dioica (Tunicate) Whole genome shotgun assembly, allelic scaffold set, scaffold scaffoldA_81

Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Oikopleura dioica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Tunicata: N E > Appendicularia: N E > Oikopleuridae: N E > Oikopleura: N E > Oikopleura dioica: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : FN654355, FN653015
2 UniProt : E4YA76, E4WQR2
2 UniProt : E4YA76, E4WQR2
2 Interpro : E4YA76, E4WQR2
2 Pfam : E4YA76, E4WQR2
2 PIRSF : E4YA76, E4WQR2
2 SUPERFAM : E4YA76, E4WQR2
Sequence
Graphical view for this peptide sequence: oikdi-e4ya76
Colored MSA for DPP4N_Peptidase_S9 (raw)
MDSVPEMRGSQNGIHPRIPVSYDLYKELKSEASSEMQEGNVSCLKFVPLP
STVGKCRLAFMGRSSNPMAAPDPNLMFIDVDPLLRNVDLTNWSDLIKPLR
IDDRKKQRSVQHDLLLERKRQSPTKGVNDFSFTGNRLLIHGGKTSIFYAD
VGEIPKFVTHEVPALDDEPRMDPKLCPGDVNFMAFYRNGNLWLQNIKKNG
EVFQLTIAGQENKDFKGIYAGWVNYLIQEEFDRYSGYYWQETQSRTQRIV
YEVSDESELETLTYVNHVAVAQKICRAGGATSGSARSAAATEAVFPSTGS
ENPKTDIRFVEFELPGSDAEDNLNVRRYKLPMPLMEYLPWTETEKQGYVV
RYGWLGEAGIWAHVLTRLQNKSAVVFIPITSFIDEESVISDDFVQTSPVF
ILHQWTSETWIKETDSVHFFDLKMAENGEEGRLEFIFHFENMAGFEHLFH
LTSMVNWNSERIADLPTIICETMIRPITSGNWQVLNTGIDIDFANQLVYF
QGTRDSPLETHLYRVNYAKGSAHNESCLRLTKAKFTHFEISVFIKENLFL
VKSSNLTTPTSIEAYRLVIFLKEGVCPRPLAYLADDVDAPGPEIFSFKNS
DGDEIFGQIYKPENFDSSKKYPTIVYVYGGPRVQNIKNQFSASRSERHRM
YSKFGYVVLTFDNRGSDNRGLKFEGVIKNHMGFFEVQDQVEGVKYVSQTM
GIIDENRVAIEGWSYGGFMSLMAIAQYPGVFKIAISGAPVVDWRLYDSAY
TERYLGLPEENPQAYNDSSVVQQVQNLPDEPNRLLLFHGMIDENVITTNM
MVLIEKLTRACKPYDLKLFVQERHSMRSSRTVEYYEMTVLTYLQQFL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDSVPEMRGSQNGIHPRIPVSYDLYKELKSEASSEMQEGNVSCLKFVPLP
STVGKCRLAFMGRSSNPMAAPDPNLMFIDVDPLLRNVDLTNWSDLIKPLR
IDDRKKQRSVQHDLLLERKRQSPTKGVNDFSFTGNRLLIHGGKTSIFYAD
VGEIPKFVTHEVPALDDEPRMDPKLCPGDVNFMAFYRNGNLWLQNIKKNG
EVFQLTIAGQENKDFKGIYAGWVNYLIQEEFDRYSGYYWQETQSRTQRIV
YEVSDESELETLTYVNHVAVAQKICRAGGATSGSARSAAATEAVFPSTGS
ENPKTDIRFVEFELPGSDAEDNLNVRRYKLPMPLMEYLPWTETEKQGYVV
RYGWLGEAGIWAHVLTRLQNKSAVVFIPITSFIDEESVISDDFVQTSPVF
ILHQWTSETWIKETDSVHFFDLKMAENGEEGRLEFIFHFENMAGFEHLFH
LTSMVNWNSERIADLPTIICETMIRPITSGNWQVLNTGIDIDFANQLVYF
QGTRDSPLETHLYRVNYAKGSAHNESCLRLTKAKFTHFEISVFIKENLFL
VKSSNLTTPTSIEAYRLVIFLKEGVCPRPLAYLADDVDAPGPEIFSFKNS
DGDEIFGQIYKPENFDSSKKYPTIVYVYGGPRVQNIKNQFSASRSERHRM
YSKFGYVVLTFDNRGSDNRGLKFEGVIKNHMGFFEVQDQVEGVKYVSQTM
GIIDENRVAIEGWSYGGFMSLMAIAQYPGVFKIAISGAPVVDWRLYDSAY
TERYLGLPEENPQAYNDSSVVQQVQNLPDEPNRLLLFHGMIDENVITTNM
MVLIEKLTRACKPYDLKLFVQERHSMRSSRTVEYYEMTVLTYLQQFL


Reference
    Title: Plasticity of animal genome architecture unmasked by rapid evolution of a pelagic tunicate
    Denoeud F, Henriet S, Mungpakdee S, Aury JM, Da Silva C, Brinkmann H, Mikhaleva J, Olsen LC, Jubin C and Chourrout D <46 more author(s)>
    Ref: Science, 330:1381, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer