Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: opitp-b1zrm2

Opitutus terrae (strain DSM 11246 / PB90-1). Alpha/beta hydrolase fold

Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Opitutus terrae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > PVC group: N E > Verrucomicrobia: N E > Opitutae: N E > Opitutales: N E > Opitutaceae: N E > Opitutus: N E > Opitutus terrae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP001032
1 UniProt : B1ZRM2
1 UniProt : B1ZRM2
1 Interpro : B1ZRM2
1 Pfam : B1ZRM2
1 PIRSF : B1ZRM2
1 SUPERFAM : B1ZRM2
Sequence
Graphical view for this peptide sequence: opitp-b1zrm2
Colored MSA for Proline_iminopeptidase (raw)
MAPVPLTMIRLSDPTENKAIAPVWADPENVTIASLDPHPRRIEFLQTVVL
GGVPQAIHVHGEDAGLPLLLFLHGGPGLPHMPFAHVNADLARWFLVVNWD
QRGAGKSYSPSLRGAHFSAEQFVSDTHDLILWLLERFGKSRLVLAGHSWG
SALGAIVASRYPHLVAAFVGLGQVTNLRVAEQMRFQMARTLAREQQNRAA
ADALATLGPPPYRSARESDALERWTCRLTGDCHCPIEDSRFLRLALLSPV
YSWLDLLRIPLGVRLSGRCFWEELFHGIDLFSQVPKLDVPAFFIVGRNDA
VVTHGLVRRYFETLVAPRGKSFITFDHSGHWPQLEEPGCFRSVLTGPVWH
GLRHGFDARSFTCAGWSGRQPDGDNLDAVTNGADRERSAGVFSTDREAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAPVPLTMIRLSDPTENKAIAPVWADPENVTIASLDPHPRRIEFLQTVVL
GGVPQAIHVHGEDAGLPLLLFLHGGPGLPHMPFAHVNADLARWFLVVNWD
QRGAGKSYSPSLRGAHFSAEQFVSDTHDLILWLLERFGKSRLVLAGHSWG
SALGAIVASRYPHLVAAFVGLGQVTNLRVAEQMRFQMARTLAREQQNRAA
ADALATLGPPPYRSARESDALERWTCRLTGDCHCPIEDSRFLRLALLSPV
YSWLDLLRIPLGVRLSGRCFWEELFHGIDLFSQVPKLDVPAFFIVGRNDA
VVTHGLVRRYFETLVAPRGKSFITFDHSGHWPQLEEPGCFRSVLTGPVWH
GLRHGFDARSFTCAGWSGRQPDGDNLDAVTNGADRERSAGVFSTDREAA


Reference
    Title: Genome sequence of the verrucomicrobium Opitutus terrae PB90-1, an abundant inhabitant of rice paddy soil ecosystems
    van Passel MW, Kant R, Palva A, Copeland A, Lucas S, Lapidus A, Glavina Del Rio T, Pitluck S, Goltsman E and Smidt H <11 more author(s)>
    Ref: Journal of Bacteriology, 193:2367, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer