Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysa-Q7XTM8

Oryza sativa (Rice) osjnba0033g05.17 protein h0413e07.8 protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AL606454, AL732331
1 UniProt : Q25A86
2 UniProt : Q7XTM8, Q25A86
2 Interpro : Q7XTM8, Q25A86
2 Prodom : Q7XTM8, Q25A86
2 Pfam : Q7XTM8, Q25A86
2 PIRSF : Q7XTM8, Q25A86
2 SUPERFAM : Q7XTM8, Q25A86
Sequence
Graphical view for this peptide sequence: orysa-Q7XTM8
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MSCCPCTTTTSSPLSLPRPACRGRWSGGGGSSANAAAWRARGGGAKRSLV
VAASGSKDETAEGKKQEEESEFNPFGFVTDNPSSRGAIQLPESPAQDGNV
GQMLYRIEDKGREFGSRVKSGKLRWFVRETGSAGARRGTVVFIHGAPSQS
FSYRMVMSQMADAGYHCFAPDWIGFGFSDMPQPGYGFDYTEEEFHKSLDE
LLSTLNITEPFFLVVQGFLVGSYGLTWALKNSSKVLKVAILNSPLTVSSP
VPGLFNQLRLPLFGEFTCQNAVLAERFIEAGSPYVLKSEKADVYRLPYLS
SGAPGFALLEAARKANFRDVLSRISAGFASNSWEKPILLAWGISDKYLPL
PIAEEFQKGNPAAIKLEPIEGAGHMPQEDWPEKVVTALRSFL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSCCPCTTTTSSPLSLPRPACRGRWSGGGGSSANAAAWRARGGGAKRSLV
VAASGSKDETAEGKKQEEESEFNPFGFVTDNPSSRGAIQLPESPAQDGNV
GQMLYRIEDKGREFGSRVKSGKLRWFVRETGSAGARRGTVVFIHGAPSQS
FSYRMVMSQMADAGYHCFAPDWIGFGFSDMPQPGYGFDYTEEEFHKSLDE
LLSTLNITEPFFLVVQGFLVGSYGLTWALKNSSKVLKVAILNSPLTVSSP
VPGLFNQLRLPLFGEFTCQNAVLAERFIEAGSPYVLKSEKADVYRLPYLS
SGAPGFALLEAARKANFRDVLSRISAGFASNSWEKPILLAWGISDKYLPL
PIAEEFQKGNPAAIKLEPIEGAGHMPQEDWPEKVVTALRSFL


Reference
    Title: Sequence and analysis of rice chromosome 4
    Feng Q, Zhang Y, Hao P, Wang S, Fu G, Huang Y, Li Y, Zhu J, Liu Y and Han B <61 more author(s)>
    Ref: Nature, 420:316, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer