Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: phyrm-h3gbl6.2

Phytophthora ramorum (Sudden oak death agent) Uncharacterized protein

Comment
2 sequences concatened Pfam A Abhydrolase_6 47 288 Pfam A Abhydrolase_6 397 638


Relationship
Family|ABHD6-Lip
Block| X
Position in NCBI Life Tree|Phytophthora ramorum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Stramenopiles: N E > Oomycetes: N E > Peronosporales: N E > Phytophthora: N E > Phytophthora ramorum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 UniProt : H3GBL6
1 UniProt : H3GBL6
1 Interpro : H3GBL6
1 Prodom : H3GBL6
1 Pfam : H3GBL6
1 PIRSF : H3GBL6
1 SUPERFAM : H3GBL6
Sequence
Graphical view for this peptide sequence: phyrm-h3gbl6.2
Colored MSA for ABHD6-Lip (raw)
LVIPSLRLAAPRASKTSPKLPTAMMNSLLMSVFDAIRFVSGFSAKNASVD
KYNWSYIERPGKDEKDTDVVVFLHGFSSMKESWVRVARGVDKRYKIMIPD
LPGQGRTTPVDALANYSMPSQAERLHEFLEKELPADKKIHLVGCSMGGML
AGVYAGMYPDRVKSLTMVCPAGITMPRKSTLLKMLEDSGRNLLLAHTPED
VNEMNEALSFESRKIPHVISSIIASEREKQLPVLEKIVGDSLQNPTVLED
LLPNIRAKTLVMWGKHDRVLDVSSVEVLEKKLTPEAQGQVLLFDDCGHIL
QHEKHAECTAAINKFLAGEALSMKNLM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

LVIPSLRLAAPRASKTSPKLPTAMMNSLLMSVFDAIRFVSGFSAKNASVD
KYNWSYIERPGKDEKDTDVVVFLHGFSSMKESWVRVARGVDKRYKIMIPD
LPGQGRTTPVDALANYSMPSQAERLHEFLEKELPADKKIHLVGCSMGGML
AGVYAGMYPDRVKSLTMVCPAGITMPRKSTLLKMLEDSGRNLLLAHTPED
VNEMNEALSFESRKIPHVISSIIASEREKQLPVLEKIVGDSLQNPTVLED
LLPNIRAKTLVMWGKHDRVLDVSSVEVLEKKLTPEAQGQVLLFDDCGHIL
QHEKHAECTAAINKFLAGEALSMKNLM


Reference
    Title: Phytophthora genome sequences uncover evolutionary origins and mechanisms of pathogenesis
    Tyler BM, Tripathy S, Zhang X, Dehal P, Jiang RH, Aerts A, Arredondo FD, Baxter L, Bensasson D and Boore JL <43 more author(s)>
    Ref: Science, 313:1261, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer