Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: picso-g8ycc9

Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) (Hybrid yeast) Piso0_002342 protein

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Pichia sorbitophila
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Debaryomycetaceae: N E > Millerozyma: N E > Millerozyma farinosa: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FO082050
1 UniProt : G8YCC9
1 UniProt : G8YCC9
1 Interpro : G8YCC9
1 Pfam : G8YCC9
1 PIRSF : G8YCC9
1 SUPERFAM : G8YCC9
Sequence
Graphical view for this peptide sequence: picso-g8ycc9
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MGQQVSTEAATKFRHNTPIGDFQGLTIRDPVTESPQCYRFTNIRYGAPPM
NESRWKKPKAVPQDYSYSDHSYCDLGKPCYQPRILEPKLAPLYNLGESGE
DCTYLNIWIPANLDLKDSNVEKLPVFFYIHGGWLQYGSPNLDSSMDPRYL
HELEESGHKYIVVAPAYRLNVFGFLSCEYLEKLGSGANFGLWDQRLALEW
TYNNIKYFGGDPDRITVGGLSAGSYSTFLQLAYEVYHPEETQIIKQVVHF
SNCILFQPKSISETNVQFEELCDTLGVDTNLDAAGKLEALKGIDPKSLAD
VLPEMSLHTFRAVTDDDFVSASLIKDIQSGLYAKTLAAKKVRIIIGEVSN
EPVMYSYLNTPIDLEALSLQLENYYPKAVVPTLLSLYLNPDELPDTKNSL
RELFGEIVASSQVYASSRGFLHYLTSQGFFPESSIYRFKCSFSPELMKER
LSKMGVKGPIHGGDQPLWFFATSAGIKDHEKEKIIKFIGPLSEFIHCKDI
RETWGTSGIKLYRHLQEDGSTVIEEDSDWLRDVANAKKLIEVQI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGQQVSTEAATKFRHNTPIGDFQGLTIRDPVTESPQCYRFTNIRYGAPPM
NESRWKKPKAVPQDYSYSDHSYCDLGKPCYQPRILEPKLAPLYNLGESGE
DCTYLNIWIPANLDLKDSNVEKLPVFFYIHGGWLQYGSPNLDSSMDPRYL
HELEESGHKYIVVAPAYRLNVFGFLSCEYLEKLGSGANFGLWDQRLALEW
TYNNIKYFGGDPDRITVGGLSAGSYSTFLQLAYEVYHPEETQIIKQVVHF
SNCILFQPKSISETNVQFEELCDTLGVDTNLDAAGKLEALKGIDPKSLAD
VLPEMSLHTFRAVTDDDFVSASLIKDIQSGLYAKTLAAKKVRIIIGEVSN
EPVMYSYLNTPIDLEALSLQLENYYPKAVVPTLLSLYLNPDELPDTKNSL
RELFGEIVASSQVYASSRGFLHYLTSQGFFPESSIYRFKCSFSPELMKER
LSKMGVKGPIHGGDQPLWFFATSAGIKDHEKEKIIKFIGPLSEFIHCKDI
RETWGTSGIKLYRHLQEDGSTVIEEDSDWLRDVANAKKLIEVQI


Reference
    Title: Pichia sorbitophila, an Interspecies Yeast Hybrid, Reveals Early Steps of Genome Resolution After Polyploidization
    Louis VL, Despons L, Friedrich A, Martin T, Durrens P, Casaregola S, Neuveglise C, Fairhead C, Marck C and Souciet JL <33 more author(s)>
    Ref: G3 (Bethesda), 2:299, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer