Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psesm-IRP1

Pseudomonas syringae (pv. tomato) yersiniabactin polyketide/non-ribosomal peptide synthetase

Comment
Other strains: Pseudomonas syringae pv. tomato (strain DC3000; T1) Thioesterase Cterm module only


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Pseudomonas syringae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas syringae group: N E > Pseudomonas syringae group genomosp. 1: N E > Pseudomonas syringae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AE016865
1 UniProt : Q882M6
1 UniProt : Q882M6
1 Interpro : Q882M6
1 Pfam : Q882M6
1 PIRSF : Q882M6
1 SUPERFAM : Q882M6
Sequence
Graphical view for this peptide sequence: psesm-IRP1
Colored MSA for Thioesterase (raw)
FFLSGGDSLIATRMIARLNRMGHSGSSLRNLFDNPRLSDFCATLLDHSVQ
TDDNPLALARGRNTLSLFVFHASDGEVSAYLPLAQALDMQVFGLQATNAL
GSASLKALAAQYEQAIRRQQASGPYVLLGWSYGTFVAEETARLLLRQGEQ
VRLILLDPVCRADLRFDDRPGLLRLMAEGAKSIALPDDLEQLPAAEQLNV
FMNNATQAGVLKNPPQAQQAEQWLQRIEHLMTLLAQHSQPRQLDLPCLWL
SAEGRPQHWLPAEQDWQEWAATARRESMPCDHWQLLLDSDQVQRTAASIS
AWLAATHKESHP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

FFLSGGDSLIATRMIARLNRMGHSGSSLRNLFDNPRLSDFCATLLDHSVQ
TDDNPLALARGRNTLSLFVFHASDGEVSAYLPLAQALDMQVFGLQATNAL
GSASLKALAAQYEQAIRRQQASGPYVLLGWSYGTFVAEETARLLLRQGEQ
VRLILLDPVCRADLRFDDRPGLLRLMAEGAKSIALPDDLEQLPAAEQLNV
FMNNATQAGVLKNPPQAQQAEQWLQRIEHLMTLLAQHSQPRQLDLPCLWL
SAEGRPQHWLPAEQDWQEWAATARRESMPCDHWQLLLDSDQVQRTAASIS
AWLAATHKESHP


References
    Title: A draft genome sequence of Pseudomonas syringae pv. tomato T1 reveals a type III effector repertoire significantly divergent from that of Pseudomonas syringae pv. tomato DC3000
    Almeida NF, Yan S, Lindeberg M, Studholme DJ, Schneider DJ, Condon B, Liu H, Viana CJ, Warren A and Vinatzer BA <8 more author(s)>
    Ref: Mol Plant Microbe Interact, 22:52, 2009 : PubMed

            

    Title: The complete genome sequence of the Arabidopsis and tomato pathogen Pseudomonas syringae pv. tomato DC3000
    Buell CR, Joardar V, Lindeberg M, Selengut J, Paulsen IT, Gwinn ML, Dodson RJ, DeBoy RT, Durkin AS and Collmer A <34 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:10181, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer