shifl-YJFP

 
Shigella flexneri, Shigella sonnei, Shigella dysenteriae, Shigella boydii, hypothetical protein yjfp

Comment
Other strains: Shigella flexneri (and serotype X (strain 2002017) serotype 5b (strain 8401)) and Shigella sonnei, Shigella dysenteriae (1012; Sd197) Shigella boydii (serotype 4 (strain Sb227) serotype 18 (strain CDC 3083-94 / BS512))


Relationship
Block X
Shigella flexneri position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Shigella: N E > Shigella flexneri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 7 more: CP000034, CP000266, CP000036
>3 UniProt links 5 more: Q328K7, Q0SX95, Q83IJ1
>3 UniProtTrembl links 5 more: Q83IJ1, Q328K7, Q0SX95
>3 Interpro links 5 more: Q83IJ1, Q328K7, Q0SX95
>3 Prodom links 5 more: Q83IJ1, Q328K7, Q0SX95
>3 Pfam links 5 more: Q83IJ1, Q328K7, Q0SX95
>3 PIRSF links 5 more: Q83IJ1, Q328K7, Q0SX95
>3 SUPERFAM links 5 more: Q83IJ1, Q328K7, Q0SX95
>3 QuickSwissBlast links 5 more: Q83IJ1, Q328K7, Q0SX95
 
Sequence
Graphical view for this peptide sequence: shifl-YJFP
Colored MSA for 5_AlphaBeta_hydrolase (raw)
MIEIESRELADIPVLHAYPVGQKDTPLPCVIFYHGFTSSSLVYSYFAVAL
AQAGLRVIMPDAPDHGSRFSGDEARRLNQFWQILLQSMQEFTTLRAAIAE
ENWLLDDRLAVGGASMGAMTALGITARHPTVKCTASMMGSGYFTSLARSL
FPPLIPETAAQQNEFNKIVAPLAEWEATNHLEQLGDRPLLLWHGLDDDVV
PADESLRLQQALSETGRDKLLTCSWQPGVRHRITPEALDAAVTFFRQHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIEIESRELADIPVLHAYPVGQKDTPLPCVIFYHGFTSSSLVYSYFAVAL
AQAGLRVIMPDAPDHGSRFSGDEARRLNQFWQILLQSMQEFTTLRAAIAE
ENWLLDDRLAVGGASMGAMTALGITARHPTVKCTASMMGSGYFTSLARSL
FPPLIPETAAQQNEFNKIVAPLAEWEATNHLEQLGDRPLLLWHGLDDDVV
PADESLRLQQALSETGRDKLLTCSWQPGVRHRITPEALDAAVTFFRQHL

no DNA




References
2 more
    Title: Emergence of a new multidrug-resistant serotype X variant in an epidemic clone of Shigella flexneri
    Ye C, Lan R, Xia S, Zhang J, Sun Q, Zhang S, Jing H, Wang L, Li Z and Xu J <11 more author(s)>
    Ref: J Clin Microbiol, 48:419, 2010 : PubMed

            

    Title: Complete genome sequence of Shigella flexneri 5b and comparison with Shigella flexneri 2a
    Nie H, Yang F, Zhang X, Yang J, Chen L, Wang J, Xiong Z, Peng J, Sun L and Jin Q <6 more author(s)>
    Ref: BMC Genomics, 7:173, 2006 : PubMed

            

    Title: Genome dynamics and diversity of Shigella species, the etiologic agents of bacillary dysentery
    Yang F, Yang J, Zhang X, Chen L, Jiang Y, Yan Y, Tang X, Wang J, Xiong Z and Jin Q <17 more author(s)>
    Ref: Nucleic Acids Research, 33:6445, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer