Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-SCYNR064C

Saccharomycescerevisiae SCYNR064C

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Cis-stilbene-oxide
No inhibitor
2 Genbank : Z71679, Y13139
1 UniProt : P53750
1 Ncbi-nid : 1302591
1 Ncbi-pid : 1302592
1 UniProt : P53750
1 Interpro : P53750
1 Prodom : P53750
1 Pfam : P53750
1 PIRSF : P53750
1 SUPERFAM : P53750
1 SGD : S0005347
Sequence
Graphical view for this peptide sequence: yeast-SCYNR064C
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MSNIIARFHKIQVQDGVKVWYREAGAAGNPTILLLHGFPTSSNMFRNLIP
LLAGQFHIIAPDLPGFGFTETPENYKFSFDSLCESIGYLLDTLSIEKFAM
YIFDYGSPVGFRLALKFPSRITGIVTQNGNAYEEGLDDRFWGPLKEYWKS
YQSDPVFVKSLIPYLEDPANVICQYHDGVPAIESVDPAAYTLDIALIQRT
GQTDIQLRLFFDYQNNIKLYPAFQKFLRDSKIPVLVAWGANDTIFSVAGA
EAYRKDVDNLKVVYYDTGHFALETHVVAIAEEIISMFAEN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNIIARFHKIQVQDGVKVWYREAGAAGNPTILLLHGFPTSSNMFRNLIP
LLAGQFHIIAPDLPGFGFTETPENYKFSFDSLCESIGYLLDTLSIEKFAM
YIFDYGSPVGFRLALKFPSRITGIVTQNGNAYEEGLDDRFWGPLKEYWKS
YQSDPVFVKSLIPYLEDPANVICQYHDGVPAIESVDPAAYTLDIALIQRT
GQTDIQLRLFFDYQNNIKLYPAFQKFLRDSKIPVLVAWGANDTIFSVAGA
EAYRKDVDNLKVVYYDTGHFALETHVVAIAEEIISMFAEN


References
    Title: The Saccharomyces cerevisiae ORF YNR064c protein has characteristics of an 'orphaned' epoxide hydrolase
    Elfstrom LT, Widersten M
    Ref: Biochimica & Biophysica Acta, 1748:213, 2005 : PubMed

            

    Title: The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications
    Philippsen P, Kleine K, Pohlmann R, Dusterhoft A, Hamberg K, Hegemann JH, Obermaier B, Urrestarazu LA, Aert R and Hani J <78 more author(s)>
    Ref: Nature, 387:93, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer