9gamm-q4a538

Vibrio salmonicida Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238)) luxd

Comment

Relationship

Family : Thioesterase_acyl-transferase

Block : X

Position in NCBI Life Tree : Vibrio salmonicida

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MDHFAGLAEYLSSNGFHVIRYDSLHHVGLSSGDINEFSMS
IGKDSLLTVI DWLKGRNIEKLGLIAASLSARIAYEIANE
IDLSFLVTAVGVVNLRDTLER ALKYDYLQLPIEKLPEDL
DFEGHNLGSEVFVTDCFKHKWDTLDSTINKMK NLDVPFI
AFTANDDNWVKQSEVLDLLISLNSEKCKLYSLIGSSHDLG
ENL VVLRNFYQSVTKAAIALDNDSLDLDVNMTEPRFEDI
TSVTVKERRLKNQI ENESLELV

References

Title : Complete genome sequence of the oral pathogenic Bacterium porphyromonas gingivalis strain W83 - Nelson_2003_J.Bacteriol_185_5591
Author(s) : Nelson KE , Fleischmann RD , DeBoy RT , Paulsen IT , Fouts DE , Eisen JA , Daugherty SC , Dodson RJ , Durkin AS , Gwinn M , Haft DH , Kolonay JF , Nelson WC , Mason T , Tallon L , Gray J , Granger D , Tettelin H , Dong H , Galvin JL , Duncan MJ , Dewhirst FE , Fraser CM
Ref : Journal of Bacteriology , 185 :5591 , 2003
Abstract : Nelson_2003_J.Bacteriol_185_5591
ESTHER : Nelson_2003_J.Bacteriol_185_5591
PubMedSearch : Nelson_2003_J.Bacteriol_185_5591
PubMedID: 12949112
Gene_locus related to this paper: 9gamm-q4a538 , porgi-DPP , porgi-q7mtk3 , porgi-q7mu18 , porgi-q7mub3 , porgi-q7muw6 , porgi-q7mvp4 , porgi-q7mwa7 , porgi-q7mx03