Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycle-ML0376

Mycobacterium leprae putative membrane protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Mycobacterium leprae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium leprae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AL583918
1 UniProt : Q9CCV4
1 Interpro : Q9CCV4
1 Pfam : Q9CCV4
1 PIRSF : Q9CCV4
1 SUPERFAM : Q9CCV4
Sequence
Graphical view for this peptide sequence: mycle-ML0376
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MTDDEIRRRRNGRPWLAGGTGLVPVATIVGALSLRSIFERDNACRDPYVD
RDFEKLGDERRCWVTISGGMALVVREEGAVKAPVAMVFAYGFYLRMDSFH
FQRKRFGKRWGPQVRMVFYDHCGHVQSSEVALDTYTLTQLGQDLRTVLQT
VTPHGMIVLVGHSMEGILKSPALEAVRLTSRSASKLMHRGSIASQSLIGP
ILRAASYSDLRVSRGLDAFSQRIMNDTLIAILVSFLHALELHEETAGLWP
LLRVPALIACGDHDLLTSDERSRGMAAVLPLLALVIVSGASRLALLDKPG
AINDGLVRLVNRAVPGKAALRYRRFKERLQRHG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTDDEIRRRRNGRPWLAGGTGLVPVATIVGALSLRSIFERDNACRDPYVD
RDFEKLGDERRCWVTISGGMALVVREEGAVKAPVAMVFAYGFYLRMDSFH
FQRKRFGKRWGPQVRMVFYDHCGHVQSSEVALDTYTLTQLGQDLRTVLQT
VTPHGMIVLVGHSMEGILKSPALEAVRLTSRSASKLMHRGSIASQSLIGP
ILRAASYSDLRVSRGLDAFSQRIMNDTLIAILVSFLHALELHEETAGLWP
LLRVPALIACGDHDLLTSDERSRGMAAVLPLLALVIVSGASRLALLDKPG
AINDGLVRLVNRAVPGKAALRYRRFKERLQRHG


Reference
    Title: Massive gene decay in the leprosy bacillus
    Cole ST, Eiglmeier K, Parkhill J, James KD, Thomson NR, Wheeler PR, Honore N, Garnier T, Churcher C and Barrell BG <34 more author(s)>
    Ref: Nature, 409:1007, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer