borbr-BB1247

Bordetella bronchiseptica (Alcaligenes bronchisepticus) Bordetella parapertussis putative hydrolase

Comment

"Q7WMZ3 BB1247 Bordetella bronchiseptica (Alcaligenes bronchisepticus)Q7WBH1 BPP1032 Bordetella parapertussis"

Relationship

Family : 6_AlphaBeta_hydrolase

Block : X

Position in NCBI Life Tree : Bordetella bronchiseptica

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTQSSQTTSPSADARVKHRYLDLDELRIFYREAGPADAPV
VLLPHGYPCS SFQYRDFMPALADQWRLLAPDFPGFGYSD
TPDTARFACDFEHYTDFLQQF AHALGLPSYALYLHDYGS
QIGLRLAMREPDKVSGLIIQNGDIYEDELGPR YAPLQAY
WADPTLEGRYKLSLAVSEEGFRDEFLNDLPDERADCITPD
MWK LAWALLREPRRREIMVGLMEGLEDNLAWFPRYQAYL
RERQPPTLIVWGVH DGYMPEAAARAYLRDLPDAELHLLP
AGHWALETHLAPIVALTRAFLQRVH ATPNFPPP

References

Title : Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica - Parkhill_2003_Nat.Genet_35_32
Author(s) : Parkhill J , Sebaihia M , Preston A , Murphy LD , Thomson N , Harris DE , Holden MT , Churcher CM , Bentley SD , Mungall KL , Cerdeno-Tarraga AM , Temple L , James K , Harris B , Quail MA , Achtman M , Atkin R , Baker S , Basham D , Bason N , Cherevach I , Chillingworth T , Collins M , Cronin A , Davis P , Doggett J , Feltwell T , Goble A , Hamlin N , Hauser H , Holroyd S , Jagels K , Leather S , Moule S , Norberczak H , O'Neil S , Ormond D , Price C , Rabbinowitsch E , Rutter S , Sanders M , Saunders D , Seeger K , Sharp S , Simmonds M , Skelton J , Squares R , Squares S , Stevens K , Unwin L , Whitehead S , Barrell BG , Maskell DJ
Ref : Nat Genet , 35 :32 , 2003
Abstract : Parkhill_2003_Nat.Genet_35_32
ESTHER : Parkhill_2003_Nat.Genet_35_32
PubMedSearch : Parkhill_2003_Nat.Genet_35_32
PubMedID: 12910271
Gene_locus related to this paper: borbr-BB0273 , borbr-BB0570 , borbr-BB0670 , borbr-BB1064 , borbr-BB1079 , borbr-BB1247 , borbr-BB1498 , borbr-BB2718 , borbr-BB4129 , borbr-BB4247 , borbr-MHPC , borbr-q7wdw1 , borbr-q7wiz8 , borbr-q7wk25 , borbr-q7wmc2 , borbr-q7wpd9 , borpa-q7w3f3 , borpa-q7w9v8 , borpe-BIOH , borpe-BP0300 , borpe-BP2114 , borpe-BP2146 , borpe-BP2511 , borpe-BP3096 , borpe-BP3623 , borpe-BP3691 , borpe-CATD2 , borpe-METX , borpe-O30449 , borpe-PHBC , borpe-q7vsl4 , borpe-q7vt07 , borpe-q7vtg0 , borpe-q7vtv2 , borpe-q7vus4 , borpe-q7vuv4 , borpe-q7vv11 , borpe-q7vv48 , borpe-q7vvf6 , borpe-q7vwu4 , borpe-q7vyn0 , borpe-q7vyq4 , borpe-q7vz26 , borpe-q7vzb4 , borpe-q7vzj6 , borpe-q7w073