brafl-c3yz04

Branchiostoma floridae (Florida lancelet) (Amphioxus) Putative uncharacterized protein

Comment

Relationship

Family : DPP4N_Peptidase_S9

Block : X

Position in NCBI Life Tree : Branchiostoma floridae

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAQLGMAAVVGRAADGDLMIARTHIFRDDKAKLATRKALL
VTLGVIVLIA AITAAITVPLFLLYGGTPDNRPSYTFDDM
FNQKFSYKGFSARWINDEDYL YRDEDGAVLTKNVRTNMT
TVLMDNTTFTEYDAFDYRVSPDMQYVLLSYNY RKVFRHS
FTANCLIYDVQGSVVTAWIPYDDVQYAAWAPVGHKLVFVY
KNN IYLKTDFSGNDSQPITTDGMEGVIFNGVPDWVYEEE
VFSTDHTIWWSSDG NLLAFAKFNDTQVPIMSFSHYGETQ
YPRIMDIHYPKAGRTNPTVSLHVVD TTNPAFPTQEVPAP
AGFSEIYLYVVSWASNSQLYTNWIPRPQNTSIVNIC DVT
QTPISCTMIDYQESTTGWIGVFGPSFPMFIEGGSKYLIIQ
PHDEGSG AGKFRHLCLRTITQGDEASRQWLTTGQFEVTS
ILSYDEANGIVYFISNEE IPRQRHLYSLTVSNPEDKKCL
TCNLWDDCGYYSAYFSKNASWYILNCRDV LLQDNEELRT
LMDNTQLPVKRYQKFTVSGYDLWAEMFLPPNFDERKEYPV
LFDVYAGPYSQKVNEQFRLYWTAYLTSSLDIIVASFDGR
GSGYQGEKILH EIYRKLGTVEVEDQIEAGRQFQNLQYVD
KNKMAIWGWSYGGFVTSHVIGR GSDVFKCGIAVAPVTDY
LYYDSVYTERYMQHPQDNEKGYNDTIVMHHAEN FKKAKY
LLVHGTGDDNVHFQHTADLVDALTKAEVEFDLQQQVARAL
RNAA WQAKMATVLDTEVRKLSNFRGFQAFSFVLDRGPVH
VPVLPASNPVYLSVF QEDLSAVYREENIGLDCRLDTDVT
LHVTYDDQGDGKRKYLDLNVTSEHQA VLVLSETGAEEVK
TNRLNNTMVTLRCKVESSGQTGSIGKSAPVKSNKDVL AQ
ESAYSVPWPEAPA

References

Title : The amphioxus genome and the evolution of the chordate karyotype - Putnam_2008_Nature_453_1064
Author(s) : Putnam NH , Butts T , Ferrier DE , Furlong RF , Hellsten U , Kawashima T , Robinson-Rechavi M , Shoguchi E , Terry A , Yu JK , Benito-Gutierrez EL , Dubchak I , Garcia-Fernandez J , Gibson-Brown JJ , Grigoriev IV , Horton AC , de Jong PJ , Jurka J , Kapitonov VV , Kohara Y , Kuroki Y , Lindquist E , Lucas S , Osoegawa K , Pennacchio LA , Salamov AA , Satou Y , Sauka-Spengler T , Schmutz J , Shin IT , Toyoda A , Bronner-Fraser M , Fujiyama A , Holland LZ , Holland PW , Satoh N , Rokhsar DS
Ref : Nature , 453 :1064 , 2008
Abstract : Putnam_2008_Nature_453_1064
ESTHER : Putnam_2008_Nature_453_1064
PubMedSearch : Putnam_2008_Nature_453_1064
PubMedID: 18563158
Gene_locus related to this paper: brafl-ACHE1 , brafl-ACHE2 , brafl-ACHEA , brafl-ACHEB , brafl-c3xqm2 , brafl-c3xqm5 , brafl-c3xtl0 , brafl-c3xtl1 , brafl-c3xut6 , brafl-c3xut7 , brafl-c3xvw5 , brafl-c3xx27 , brafl-c3xx28 , brafl-c3xx30 , brafl-c3xx32 , brafl-c3xx36 , brafl-c3xx38 , brafl-c3xx39 , brafl-c3xx40 , brafl-c3xx41 , brafl-c3xxt9 , brafl-c3xyd7 , brafl-c3xyd8 , brafl-c3xyd9 , brafl-c3xye0 , brafl-c3xyt7 , brafl-c3xzy1 , brafl-c3xzy2 , brafl-c3y1p9 , brafl-c3y1t3 , brafl-c3y2u3 , brafl-c3y4l1 , brafl-c3y6v9 , brafl-c3y6y4 , brafl-c3y7d7 , brafl-c3y7s1 , brafl-c3y8k5 , brafl-c3y8t3 , brafl-c3y8t4 , brafl-c3y8t5 , brafl-c3y8v8 , brafl-c3y8w1.1 , brafl-c3y8w2 , brafl-c3y9i7 , brafl-c3y9i8 , brafl-c3y9l9 , brafl-c3y9y3 , brafl-c3y087 , brafl-c3yan2 , brafl-c3yaw4 , brafl-c3ybw7 , brafl-c3yc67 , brafl-c3ydm8 , brafl-c3yfm5 , brafl-c3yfz8 , brafl-c3ygc7 , brafl-c3ygc9.1 , brafl-c3ygd0 , brafl-c3ygd1 , brafl-c3ygd2.1 , brafl-c3ygd4 , brafl-c3ygg6 , brafl-c3ygr1 , brafl-c3yi63 , brafl-c3yi64 , brafl-c3yi67 , brafl-c3yi68 , brafl-c3yi69 , brafl-c3yk61 , brafl-c3ykb2 , brafl-c3yla7 , brafl-c3ylp9 , brafl-c3ylq0 , brafl-c3ylq1 , brafl-c3ymu0 , brafl-c3yne9 , brafl-c3ypm6 , brafl-c3yr72 , brafl-c3yra8 , brafl-c3ys59 , brafl-c3yv27 , brafl-c3ywf1 , brafl-c3ywh9 , brafl-c3yx17 , brafl-c3yx19 , brafl-c3yxb9 , brafl-c3yxi7 , brafl-c3yyq5 , brafl-c3yz04 , brafl-c3z1c7 , brafl-c3z1u9 , brafl-c3z1v0 , brafl-c3z3n7 , brafl-c3z5c8 , brafl-c3z9f4 , brafl-c3z066 , brafl-c3z139 , brafl-c3z975 , brafl-c3zab8 , brafl-c3zab9 , brafl-c3zbr4 , brafl-c3zci7 , brafl-c3zcy8 , brafl-c3zd14 , brafl-c3zer1 , brafl-c3zf44 , brafl-c3zf47 , brafl-c3zf48 , brafl-c3zfs6 , brafl-c3zhm6 , brafl-c3ziv7.1 , brafl-c3ziv7.2 , brafl-c3zlg0 , brafl-c3zlg2 , brafl-c3zlg3 , brafl-c3zli5 , brafl-c3zme7 , brafl-c3zme8 , brafl-c3zmp8 , brafl-c3zmv1 , brafl-c3zmv2 , brafl-c3znd6 , brafl-c3znl2 , brafl-c3zqg7 , brafl-c3zqz2 , brafl-c3zs46 , brafl-c3zs49 , brafl-c3zs56 , brafl-c3zv54 , brafl-c3zvv1 , brafl-c3zwz6 , brafl-c3zxg2 , brafl-c3zxq3 , brafl-c3yim2 , brafl-c3zfs5 , brafl-c3zfs3 , brafl-c3xr79 , brafl-c3y7r2 , brafl-c3yj62 , brafl-c3zg22 , brafl-c3y2t9 , brafl-c3y2u0 , brafl-c3ycg1 , brafl-c3ycg2 , brafl-c3ycg4 , brafl-c3z1l3 , brafl-c3zn71 , brafl-c3zj72 , brafl-c3yf35 , brafl-c3z474 , brafl-c3zqr8 , brafl-c3yde6