brafl-c3zfs6

Branchiostoma floridae (Florida lancelet) (Amphioxus) Putative uncharacterized protein

Comment

Relationship

Family : Monoglyceridelipase_lysophospholip

Block : X

Position in NCBI Life Tree : Branchiostoma floridae

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MASDSQTSDDRPRTPQGVLYSELPHLVNSRGQYLFCKYWE
PQEQAPRALL MIIHGLSGHCQRYEELATELNKEGVLVFA
HDHVGHGQSQGHSADIKSFDE YVQDVLQHADKMRAAHPG
IPLFVFGQSMGGSVAILSALERPTLFAGVIVS APGVIPA
PETATRFRVSAAKALAFFAPRTGVARIEAHLLSRDTAKVK
AFK DDPLVFHGHVCARWAVEFLSAMERIQREVHNFRTPL
LALHGDQDKMALID GTKFLYQHTRRADKQLKIYPGVYHE
PLFELEPDAQTARRDIVTWVVERI

References

Title : The amphioxus genome and the evolution of the chordate karyotype - Putnam_2008_Nature_453_1064
Author(s) : Putnam NH , Butts T , Ferrier DE , Furlong RF , Hellsten U , Kawashima T , Robinson-Rechavi M , Shoguchi E , Terry A , Yu JK , Benito-Gutierrez EL , Dubchak I , Garcia-Fernandez J , Gibson-Brown JJ , Grigoriev IV , Horton AC , de Jong PJ , Jurka J , Kapitonov VV , Kohara Y , Kuroki Y , Lindquist E , Lucas S , Osoegawa K , Pennacchio LA , Salamov AA , Satou Y , Sauka-Spengler T , Schmutz J , Shin IT , Toyoda A , Bronner-Fraser M , Fujiyama A , Holland LZ , Holland PW , Satoh N , Rokhsar DS
Ref : Nature , 453 :1064 , 2008
Abstract : Putnam_2008_Nature_453_1064
ESTHER : Putnam_2008_Nature_453_1064
PubMedSearch : Putnam_2008_Nature_453_1064
PubMedID: 18563158
Gene_locus related to this paper: brafl-ACHE1 , brafl-ACHE2 , brafl-ACHEA , brafl-ACHEB , brafl-c3xqm2 , brafl-c3xqm5 , brafl-c3xtl0 , brafl-c3xtl1 , brafl-c3xut6 , brafl-c3xut7 , brafl-c3xvw5 , brafl-c3xx27 , brafl-c3xx28 , brafl-c3xx30 , brafl-c3xx32 , brafl-c3xx36 , brafl-c3xx38 , brafl-c3xx39 , brafl-c3xx40 , brafl-c3xx41 , brafl-c3xxt9 , brafl-c3xyd7 , brafl-c3xyd8 , brafl-c3xyd9 , brafl-c3xye0 , brafl-c3xyt7 , brafl-c3xzy1 , brafl-c3xzy2 , brafl-c3y1p9 , brafl-c3y1t3 , brafl-c3y2u3 , brafl-c3y4l1 , brafl-c3y6v9 , brafl-c3y6y4 , brafl-c3y7d7 , brafl-c3y7s1 , brafl-c3y8k5 , brafl-c3y8t3 , brafl-c3y8t4 , brafl-c3y8t5 , brafl-c3y8v8 , brafl-c3y8w1.1 , brafl-c3y8w2 , brafl-c3y9i7 , brafl-c3y9i8 , brafl-c3y9l9 , brafl-c3y9y3 , brafl-c3y087 , brafl-c3yan2 , brafl-c3yaw4 , brafl-c3ybw7 , brafl-c3yc67 , brafl-c3ydm8 , brafl-c3yfm5 , brafl-c3yfz8 , brafl-c3ygc7 , brafl-c3ygc9.1 , brafl-c3ygd0 , brafl-c3ygd1 , brafl-c3ygd2.1 , brafl-c3ygd4 , brafl-c3ygg6 , brafl-c3ygr1 , brafl-c3yi63 , brafl-c3yi64 , brafl-c3yi67 , brafl-c3yi68 , brafl-c3yi69 , brafl-c3yk61 , brafl-c3ykb2 , brafl-c3yla7 , brafl-c3ylp9 , brafl-c3ylq0 , brafl-c3ylq1 , brafl-c3ymu0 , brafl-c3yne9 , brafl-c3ypm6 , brafl-c3yr72 , brafl-c3yra8 , brafl-c3ys59 , brafl-c3yv27 , brafl-c3ywf1 , brafl-c3ywh9 , brafl-c3yx17 , brafl-c3yx19 , brafl-c3yxb9 , brafl-c3yxi7 , brafl-c3yyq5 , brafl-c3yz04 , brafl-c3z1c7 , brafl-c3z1u9 , brafl-c3z1v0 , brafl-c3z3n7 , brafl-c3z5c8 , brafl-c3z9f4 , brafl-c3z066 , brafl-c3z139 , brafl-c3z975 , brafl-c3zab8 , brafl-c3zab9 , brafl-c3zbr4 , brafl-c3zci7 , brafl-c3zcy8 , brafl-c3zd14 , brafl-c3zer1 , brafl-c3zf44 , brafl-c3zf47 , brafl-c3zf48 , brafl-c3zfs6 , brafl-c3zhm6 , brafl-c3ziv7.1 , brafl-c3ziv7.2 , brafl-c3zlg0 , brafl-c3zlg2 , brafl-c3zlg3 , brafl-c3zli5 , brafl-c3zme7 , brafl-c3zme8 , brafl-c3zmp8 , brafl-c3zmv1 , brafl-c3zmv2 , brafl-c3znd6 , brafl-c3znl2 , brafl-c3zqg7 , brafl-c3zqz2 , brafl-c3zs46 , brafl-c3zs49 , brafl-c3zs56 , brafl-c3zv54 , brafl-c3zvv1 , brafl-c3zwz6 , brafl-c3zxg2 , brafl-c3zxq3 , brafl-c3yim2 , brafl-c3zfs5 , brafl-c3zfs3 , brafl-c3xr79 , brafl-c3y7r2 , brafl-c3yj62 , brafl-c3zg22 , brafl-c3y2t9 , brafl-c3y2u0 , brafl-c3ycg1 , brafl-c3ycg2 , brafl-c3ycg4 , brafl-c3z1l3 , brafl-c3zn71 , brafl-c3zj72 , brafl-c3yf35 , brafl-c3z474 , brafl-c3zqr8 , brafl-c3yde6