cocp7-c5p1s3

Coccidioides posadasii (Valley fever fungus) Prolyl dipeptidyl peptidase, putative

Comment

"Other strains: Coccidioides posadasii (strains C735\; RMSCC 757 \/ Silveira) (Valley fever fungus)"

Relationship

Family : DPP4N_Peptidase_S9

Block : X

Position in NCBI Life Tree : Coccidioides posadasii

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKIASLLLLAGLCLAVDPPRKPFPPRGGGSKLLTYNETVT
RRVISPTTTF VDWIPGEEDGQYVFQENDGTLIIQNIATN
RSETLVGADKVPENSYSYYIK PDLSAVLWATNYKKQYRH
SFFADYHILDLESGSLTPLDNDQNGDIQYAAW SPKGNVI
AYVRNNNLYLWKNGEVTQITEDGGPNTFNGVPDWVYEEEI
FGT PFALWFSPDGEYVAYMRTDETGVPTYTIPYYMDNQK
FAPPYPRELELRYP KVSQTNPTVQFRLLNVESEEQKNVT
LDAFEADDLIIGEVKWLTDGHEKVA LRAFNRVQDREKII
LVDSESGAGSIIQERDGTDGWLENNQAIRYIGKIKG GRF
NSRANYYVDISDMDGWSHLYLFPVGEGEPIQLTRGRWEVT
ALNHVDT ERQLIYFVATKRHSTQRHLYSVSYRDMKIKAL
VNDREAGHYTANFSARGG YYVLHYQGPDVPYQELFATRT
GKAIRTINSNADVVNKLKEYKLPRIDYLD IRLPSGETLN
VMQRLPANFSPRKKYPVLFTPYGGPNSQQVHVGFQSFGWT
AYIASDPELEYITWTVDNRGTGFKGRKFRSTVAKRLGAL
EAEDQVYAAKV LSKFPYVDKERIGIWGTSYGGYLTAKTL
ETDSGRFSFGISSAPVSDWRFY DSMYTERYMKTYEMNEA
GYNASAVRKTEGFKNVRGSFLLQHGTGDDNVHF QHSAAL
SDLLMGAGVSPNKMAGTWFTDSDHGIRYNGGHAFQYKELT
MKLY EEKNRKFDEEKHQWSKKDLEFAASIGI

References

Title : Comparative genomic analyses of the human fungal pathogens Coccidioides and their relatives - Sharpton_2009_Genome.Res_19_1722
Author(s) : Sharpton TJ , Stajich JE , Rounsley SD , Gardner MJ , Wortman JR , Jordar VS , Maiti R , Kodira CD , Neafsey DE , Zeng Q , Hung CY , McMahan C , Muszewska A , Grynberg M , Mandel MA , Kellner EM , Barker BM , Galgiani JN , Orbach MJ , Kirkland TN , Cole GT , Henn MR , Birren BW , Taylor JW
Ref : Genome Res , 19 :1722 , 2009
Abstract : Sharpton_2009_Genome.Res_19_1722
ESTHER : Sharpton_2009_Genome.Res_19_1722
PubMedSearch : Sharpton_2009_Genome.Res_19_1722
PubMedID: 19717792
Gene_locus related to this paper: ajecg-c0nbn5 , ajecg-c0nbz4 , ajecg-c0ndw0 , ajecg-c0nqc6 , ajecg-c0nst6 , ajecg-c0ntx5 , ajecg-c0nu33 , ajecg-c0nzh6 , ajecg-c0p0h0 , ajech-c6h1y9 , ajecn-a6qs62 , ajecn-a6quy7 , ajecn-a6r2c0 , ajecn-a6r491 , ajecn-a6r635 , ajecn-a6rab7 , ajecn-a6ram0 , ajecn-a6rf08 , ajecn-a6rf70 , ajecn-atg15 , ajecn-dapb , ajeds-c5jqx1 , cocim-atg15 , cocim-bst1 , cocim-j3k8a1 , cocp7-c5p0f2 , cocp7-c5p0i6 , cocp7-c5p1s3 , cocp7-c5p1u2 , cocp7-c5p2u8 , cocp7-c5p4s8 , cocp7-c5p4z1 , cocp7-c5p5s7 , cocp7-c5p129 , cocp7-c5p172 , cocp7-c5p250 , cocps-e9ctz7 , cocp7-c5pae0 , cocp7-c5pby4 , cocp7-c5pdn8 , cocp7-c5pdv9 , cocp7-c5pe69 , cocp7-c5pf68 , cocp7-c5pgk6 , cocp7-c5pid0 , cocp7-dapb , cocps-e9cz73 , cocps-e9dbi4 , cocps-e9dbu0 , cocps-e9dfh7 , uncre-c4jf72 , uncre-c4jf79 , uncre-c4ji27 , uncre-c4jj62 , uncre-c4jjs9 , uncre-c4jk71 , uncre-c4jlm9 , uncre-c4jlp5 , uncre-c4jlr7 , uncre-c4jnk2 , uncre-c4jnn3 , uncre-c4juj6 , uncre-c4jve9 , uncre-c4jvh5 , uncre-c4jw09 , uncre-c4jyw9 , uncre-c4jzs5 , uncre-dapb , ajech-c6h9r4 , uncre-c4jds5 , cocp7-c5pii3 , ajecn-a6r5v8 , cocim-j3ka92 , cocp7-c5phc6 , ajecn-a6qtc4 , ajecn-a6r145 , cocps-e9d3i4 , cocp7-c5p7x1 , cocps-e9csw0 , ajecg-c0nww6 , ajecn-kex1 , uncre-kex1 , uncre-cbpya , cocps-kex1 , ajecn-cbpya