cocp7-c5p2u8

Coccidioides posadasii, Coccidioides immitis (Valley fever fungus) Lipase, putative

Comment

"Other strains: Coccidioides posadasii (strains C735\; RMSCC 757 \/ Silveira) Coccidioides immitis RS (Valley fever fungus)"

Relationship

Family : Fungal_carboxylesterase_lipase

Block : C

Position in NCBI Life Tree : Coccidioides posadasii

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MGNTYNSPPSALASRQLSSSISSDNSNIAAVKPPEKRFKM
TRKKLMIGIL ALLIPAACAGTGIGLALRNNRNASSCKPE
DSCRDLGYAKYQGVPDPNGVT SWLGMRYAAPPVGELRFA
APQDPAKEEGIQVANVRQKRCVSTGARIAKRE SEDCLFL
DVFAPSNATKDSKLPVFFFIQGGGFNMNANPGINASRLIQ
ASG GNLIAVGFNYRVSLYGFLAGKELEERASLNNGLKDQ
IKALEWVKTHIAQF GGDPDHVVIGGHSAGGASVVFHLTA
YGGEKCDEAPFHGAIAGSPSMGTML TVSESQFLYDSLLN
RTGCGCSRDSLKCLRNLDVKTLQSHNTKQPLPGAKV NPL
FMYSPTIDNDLVPDYTYRLLQEGKFCKVPVVFGDDQDEGT
LFASKKT KSIQDSDKFLRAQFPALTEDQLRKINSYMSTV
KPEFPDIGMHWQQLARIY GDMRYTCPKISIMESFTEFHK
HDQAWSYRYAVQDPLYLRSGLGTPHTAEL EGIWGPDYAA
GRSPMSYYTTNKEIVPVVQGYWSSFIRSLDPNKHRAQGSP
EWKTWNASSSDPNPEGFRELFIRTGDTKMRVVDSQQRER
CDYFINIGVDI KQ

References

Title : Population genomic sequencing of Coccidioides fungi reveals recent hybridization and transposon control - Neafsey_2010_Genome.Res_20_938
Author(s) : Neafsey DE , Barker BM , Sharpton TJ , Stajich JE , Park DJ , Whiston E , Hung CY , McMahan C , White J , Sykes S , Heiman D , Young S , Zeng Q , Abouelleil A , Aftuck L , Bessette D , Brown A , FitzGerald M , Lui A , Macdonald JP , Priest M , Orbach MJ , Galgiani JN , Kirkland TN , Cole GT , Birren BW , Henn MR , Taylor JW , Rounsley SD
Ref : Genome Res , 20 :938 , 2010
Abstract : Neafsey_2010_Genome.Res_20_938
ESTHER : Neafsey_2010_Genome.Res_20_938
PubMedSearch : Neafsey_2010_Genome.Res_20_938
PubMedID: 20516208
Gene_locus related to this paper: cocp7-c5p2u8 , cocp7-c5p5s7 , cocp7-c5pe69 , cocp7-c5pf68 , cocp7-c5pgk6 , cocim-j3ka92 , cocp7-c5phc6 , cocps-e9d3i4 , cocit-a0a0j8rde7 , cocps-e9csw0 , cocps-e9dgm8

Title : Comparative genomic analyses of the human fungal pathogens Coccidioides and their relatives - Sharpton_2009_Genome.Res_19_1722
Author(s) : Sharpton TJ , Stajich JE , Rounsley SD , Gardner MJ , Wortman JR , Jordar VS , Maiti R , Kodira CD , Neafsey DE , Zeng Q , Hung CY , McMahan C , Muszewska A , Grynberg M , Mandel MA , Kellner EM , Barker BM , Galgiani JN , Orbach MJ , Kirkland TN , Cole GT , Henn MR , Birren BW , Taylor JW
Ref : Genome Res , 19 :1722 , 2009
Abstract : Sharpton_2009_Genome.Res_19_1722
ESTHER : Sharpton_2009_Genome.Res_19_1722
PubMedSearch : Sharpton_2009_Genome.Res_19_1722
PubMedID: 19717792
Gene_locus related to this paper: ajecg-c0nbn5 , ajecg-c0nbz4 , ajecg-c0ndw0 , ajecg-c0nqc6 , ajecg-c0nst6 , ajecg-c0ntx5 , ajecg-c0nu33 , ajecg-c0nzh6 , ajecg-c0p0h0 , ajech-c6h1y9 , ajecn-a6qs62 , ajecn-a6quy7 , ajecn-a6r2c0 , ajecn-a6r491 , ajecn-a6r635 , ajecn-a6rab7 , ajecn-a6ram0 , ajecn-a6rf08 , ajecn-a6rf70 , ajecn-atg15 , ajecn-dapb , ajeds-c5jqx1 , cocim-atg15 , cocim-bst1 , cocim-j3k8a1 , cocp7-c5p0f2 , cocp7-c5p0i6 , cocp7-c5p1s3 , cocp7-c5p1u2 , cocp7-c5p2u8 , cocp7-c5p4s8 , cocp7-c5p4z1 , cocp7-c5p5s7 , cocp7-c5p129 , cocp7-c5p172 , cocp7-c5p250 , cocps-e9ctz7 , cocp7-c5pae0 , cocp7-c5pby4 , cocp7-c5pdn8 , cocp7-c5pdv9 , cocp7-c5pe69 , cocp7-c5pf68 , cocp7-c5pgk6 , cocp7-c5pid0 , cocp7-dapb , cocps-e9cz73 , cocps-e9dbi4 , cocps-e9dbu0 , cocps-e9dfh7 , uncre-c4jf72 , uncre-c4jf79 , uncre-c4ji27 , uncre-c4jj62 , uncre-c4jjs9 , uncre-c4jk71 , uncre-c4jlm9 , uncre-c4jlp5 , uncre-c4jlr7 , uncre-c4jnk2 , uncre-c4jnn3 , uncre-c4juj6 , uncre-c4jve9 , uncre-c4jvh5 , uncre-c4jw09 , uncre-c4jyw9 , uncre-c4jzs5 , uncre-dapb , ajech-c6h9r4 , uncre-c4jds5 , cocp7-c5pii3 , ajecn-a6r5v8 , cocim-j3ka92 , cocp7-c5phc6 , ajecn-a6qtc4 , ajecn-a6r145 , cocps-e9d3i4 , cocp7-c5p7x1 , cocps-e9csw0 , ajecg-c0nww6 , ajecn-kex1 , uncre-kex1 , uncre-cbpya , cocps-kex1 , ajecn-cbpya