ajecg-c0ndw0

Ajellomyces capsulata (Darling's disease fungus) (Histoplasma capsulatum) Putative uncharacterized protein

Comment

"Other strains: Ajellomyces capsulata (strains ATCC 26029 \/ G186AR \/ H82 \/ RMSCC 2432\; NAm1 \/ WU24\; H88\; H143) (Darling's disease fungus) (Histoplasma capsulatum)"

Relationship

Family : LIDHydrolase

Block : X

Position in NCBI Life Tree : Ajellomyces capsulata

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MALVVIKLFCPTDEPESILLYFIPGNPGLIAYYHTFLSLL
SSTLISSAEY SDYDDGSAENNSSTASSSRMGKVPQYIIH
GKSMGGFEIVENGKHVSCCSP PLTNIKANGGMETQSQSQ
PQAHHHPTTKTDKLYSLSEQIEHVERNLNNFV DAWHARK
RAQTRGNDLSDDQGRWRHFGGVKVILIGHSVGAYIAMEIL
RRH REGIKQKGASADTGGAGIGATMDIVGGILLFPTVVD
IAQSSSGRKLTKLL YAPYLAFLTSLLVKFLIFMLPGSWL
RSIVGRVMGSPSENAIDTTVAFLKS ARGVEQAIHMSADE
MRDITYDKWSDEIWGIASSSSESSPMSASSSEETPL NLV
LYFAKQDHWVADRTRDEIIRVRGGVGSSSGSNGPRMQVCE
DGVVHGF CIPPVPTKRWRLWMTET

References

Title : Comparative genomic analyses of the human fungal pathogens Coccidioides and their relatives - Sharpton_2009_Genome.Res_19_1722
Author(s) : Sharpton TJ , Stajich JE , Rounsley SD , Gardner MJ , Wortman JR , Jordar VS , Maiti R , Kodira CD , Neafsey DE , Zeng Q , Hung CY , McMahan C , Muszewska A , Grynberg M , Mandel MA , Kellner EM , Barker BM , Galgiani JN , Orbach MJ , Kirkland TN , Cole GT , Henn MR , Birren BW , Taylor JW
Ref : Genome Res , 19 :1722 , 2009
Abstract : Sharpton_2009_Genome.Res_19_1722
ESTHER : Sharpton_2009_Genome.Res_19_1722
PubMedSearch : Sharpton_2009_Genome.Res_19_1722
PubMedID: 19717792
Gene_locus related to this paper: ajecg-c0nbn5 , ajecg-c0nbz4 , ajecg-c0ndw0 , ajecg-c0nqc6 , ajecg-c0nst6 , ajecg-c0ntx5 , ajecg-c0nu33 , ajecg-c0nzh6 , ajecg-c0p0h0 , ajech-c6h1y9 , ajecn-a6qs62 , ajecn-a6quy7 , ajecn-a6r2c0 , ajecn-a6r491 , ajecn-a6r635 , ajecn-a6rab7 , ajecn-a6ram0 , ajecn-a6rf08 , ajecn-a6rf70 , ajecn-atg15 , ajecn-dapb , ajeds-c5jqx1 , cocim-atg15 , cocim-bst1 , cocim-j3k8a1 , cocp7-c5p0f2 , cocp7-c5p0i6 , cocp7-c5p1s3 , cocp7-c5p1u2 , cocp7-c5p2u8 , cocp7-c5p4s8 , cocp7-c5p4z1 , cocp7-c5p5s7 , cocp7-c5p129 , cocp7-c5p172 , cocp7-c5p250 , cocps-e9ctz7 , cocp7-c5pae0 , cocp7-c5pby4 , cocp7-c5pdn8 , cocp7-c5pdv9 , cocp7-c5pe69 , cocp7-c5pf68 , cocp7-c5pgk6 , cocp7-c5pid0 , cocp7-dapb , cocps-e9cz73 , cocps-e9dbi4 , cocps-e9dbu0 , cocps-e9dfh7 , uncre-c4jf72 , uncre-c4jf79 , uncre-c4ji27 , uncre-c4jj62 , uncre-c4jjs9 , uncre-c4jk71 , uncre-c4jlm9 , uncre-c4jlp5 , uncre-c4jlr7 , uncre-c4jnk2 , uncre-c4jnn3 , uncre-c4juj6 , uncre-c4jve9 , uncre-c4jvh5 , uncre-c4jw09 , uncre-c4jyw9 , uncre-c4jzs5 , uncre-dapb , ajech-c6h9r4 , uncre-c4jds5 , cocp7-c5pii3 , ajecn-a6r5v8 , cocim-j3ka92 , cocp7-c5phc6 , ajecn-a6qtc4 , ajecn-a6r145 , cocps-e9d3i4 , cocp7-c5p7x1 , cocps-e9csw0 , ajecg-c0nww6 , ajecn-kex1 , uncre-kex1 , uncre-cbpya , cocps-kex1 , ajecn-cbpya