triad-b3rkr2

Trichoplax adhaerens (Trichoplax reptans) Putative uncharacterized protein

Comment

Relationship

Family : A85-EsteraseD-FGH

Block : X

Position in NCBI Life Tree : Trichoplax adhaerens

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSTNVELVSSARCFQSSINVYSHDSEELQCKMKFGVILPD
QAKESKLPVL YWLSGLTCTEQNFLTKSAAHKAACDNGVI
IVCPDTSPRGCNVEGEEDSWD FGTGAGFYLDATEEKWKK
HYRMYSYIVKEFPKIISANFPVIPGKQSIFGH SMGGHGA
ITIALKNPGMFKSLSAFSPISNPINGPWGKKAFTGYLGPN
QES WRCYDATELAKNYDGDEIELLVDQGAADPYLKDELL
LPNFCNACNNNKKV KLTYREHVGYDHGFYFIATFIEDHI
KYHARYLK

References

Title : The Trichoplax genome and the nature of placozoans - Srivastava_2008_Nature_454_955
Author(s) : Srivastava M , Begovic E , Chapman J , Putnam NH , Hellsten U , Kawashima T , Kuo A , Mitros T , Salamov A , Carpenter ML , Signorovitch AY , Moreno MA , Kamm K , Grimwood J , Schmutz J , Shapiro H , Grigoriev IV , Buss LW , Schierwater B , Dellaporta SL , Rokhsar DS
Ref : Nature , 454 :955 , 2008
Abstract : Srivastava_2008_Nature_454_955
ESTHER : Srivastava_2008_Nature_454_955
PubMedSearch : Srivastava_2008_Nature_454_955
PubMedID: 18719581
Gene_locus related to this paper: triad-b3rka6 , triad-b3rkc3 , triad-b3rkc4 , triad-b3rkc5 , triad-b3rkr2 , triad-b3rks9 , triad-b3rkt0 , triad-b3rl14 , triad-b3rls2 , triad-b3rnj7 , triad-b3rnw5 , triad-b3rrr2 , triad-b3rsh1 , triad-b3rsh3 , triad-b3rty7 , triad-b3ru11 , triad-b3rur2 , triad-b3rut0 , triad-b3rvc1 , triad-b3rw12 , triad-b3rwp0 , triad-b3rwr4 , triad-b3rxn2 , triad-b3ry59 , triad-b3s1y9 , triad-b3s3d8 , triad-b3s3e9 , triad-b3s8a0 , triad-b3s9x4 , triad-b3s445 , triad-b3s449 , triad-b3s478 , triad-b3s705 , triad-b3s706 , triad-b3s898 , triad-b3s899 , triad-b3s949 , triad-b3s950 , triad-b3sa20 , triad-b3sa22 , triad-b3sa23 , triad-b3sa24 , triad-b3sa25 , triad-b3sa26 , triad-b3sa27 , triad-b3sa28 , triad-b3sa29 , triad-b3sa31 , triad-b3sa33 , triad-b3sa34 , triad-b3sa36 , triad-b3sb39 , triad-b3scd3 , triad-b3scg3 , triad-b3scg4 , triad-b3scr3 , triad-b3seb0 , triad-b3seb1 , triad-b3seu9 , triad-b3sf12 , triad-b3rt61 , triad-b3rt62 , triad-b3rj15 , triad-b3sdi1