triad-b3sa33

Trichoplax adhaerens Putative uncharacterized protein

Comment

Relationship

Family : Cholinesterase-like

Block : C

Position in NCBI Life Tree : Trichoplax adhaerens

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVHTNKGPVAGIDFNVEGKTVYGYLGIPFAQPPVGSLRFQ
PPQPIETVWK QPFDATSLPYACPQGLPIPDLSQDTKHGQ
IREDCLYINVWTPSASSTSKL PVFVFIHGGAYFYGSGSR
WQGKVLASNQNIIVVTMNYRLGAFGFMTPGEK VDGKHVI
EPNLGLYDQRLALQWVRENIAQFGGDPNKITASGNSVGAM
SVG LHTMSPGSKGLIHRAILDSGTPQFPEFFHPDFTTPR
KVFEEAVKHSNCAR ANTAETVACLQDLPMQELLGAQFKT
MGVYPFGFSVAVDDQFLPDNPETLL KNGQYEKVPTMIGT
TSDDGSVFVRMGGYPDIEKGLSTENFFASIDVFFKA FSK
QTRSAIKFRYTNWIKENDPLAVRDEATKLFNDYFFAAPAD
KCAQQYA SDGVPTYYFEFAFPTKLSFIFPSYLGVTHTME
MPQVVGYPIDKPASFLAN FTDEDVKVSRRMMETWGNFIK
YGGDPNTPNLDGIAWPRFYGNSSQYYVFT ASPAVRDHLR
SNNMRFWNHLIPKLNATQPLSVATISTTSSPTTKLPLTTQ
LSPLLQELHTYRLALWITLGAACFLAILSLILGIMVAKI
RNRPMKS

References

Title : The Trichoplax genome and the nature of placozoans - Srivastava_2008_Nature_454_955
Author(s) : Srivastava M , Begovic E , Chapman J , Putnam NH , Hellsten U , Kawashima T , Kuo A , Mitros T , Salamov A , Carpenter ML , Signorovitch AY , Moreno MA , Kamm K , Grimwood J , Schmutz J , Shapiro H , Grigoriev IV , Buss LW , Schierwater B , Dellaporta SL , Rokhsar DS
Ref : Nature , 454 :955 , 2008
Abstract : Srivastava_2008_Nature_454_955
ESTHER : Srivastava_2008_Nature_454_955
PubMedSearch : Srivastava_2008_Nature_454_955
PubMedID: 18719581
Gene_locus related to this paper: triad-b3rka6 , triad-b3rkc3 , triad-b3rkc4 , triad-b3rkc5 , triad-b3rkr2 , triad-b3rks9 , triad-b3rkt0 , triad-b3rl14 , triad-b3rls2 , triad-b3rnj7 , triad-b3rnw5 , triad-b3rrr2 , triad-b3rsh1 , triad-b3rsh3 , triad-b3rty7 , triad-b3ru11 , triad-b3rur2 , triad-b3rut0 , triad-b3rvc1 , triad-b3rw12 , triad-b3rwp0 , triad-b3rwr4 , triad-b3rxn2 , triad-b3ry59 , triad-b3s1y9 , triad-b3s3d8 , triad-b3s3e9 , triad-b3s8a0 , triad-b3s9x4 , triad-b3s445 , triad-b3s449 , triad-b3s478 , triad-b3s705 , triad-b3s706 , triad-b3s898 , triad-b3s899 , triad-b3s949 , triad-b3s950 , triad-b3sa20 , triad-b3sa22 , triad-b3sa23 , triad-b3sa24 , triad-b3sa25 , triad-b3sa26 , triad-b3sa27 , triad-b3sa28 , triad-b3sa29 , triad-b3sa31 , triad-b3sa33 , triad-b3sa34 , triad-b3sa36 , triad-b3sb39 , triad-b3scd3 , triad-b3scg3 , triad-b3scg4 , triad-b3scr3 , triad-b3seb0 , triad-b3seb1 , triad-b3seu9 , triad-b3sf12 , triad-b3rt61 , triad-b3rt62 , triad-b3rj15 , triad-b3sdi1