Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: actde-CXE5

Actinidia deliciosa (Kiwi); Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) CXE5 carboxylesterase (EC 3.1.1.1)

Comment
Marshall S.D.G., Oakeshott J.G., Russell R.J., Plummer K.M., Newcomb R.D Other strains: Actinidia deliciosa (Kiwi); Actinidia chinensis var. chinensis (Chinese soft-hair kiwi)


Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Actinidia deliciosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > Ericales: N E > Actinidiaceae: N E > Actinidia: N E > Actinidia deliciosa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : DQ279918, NKQK01000007
2 UniProt : Q0ZPV3, A0A2R6RBZ6
2 UniProt : Q0ZPV3, A0A2R6RBZ6
2 Interpro : Q0ZPV3, A0A2R6RBZ6
2 Prodom : Q0ZPV3, A0A2R6RBZ6
2 Pfam : Q0ZPV3, A0A2R6RBZ6
2 PIRSF : Q0ZPV3, A0A2R6RBZ6
2 SUPERFAM : Q0ZPV3, A0A2R6RBZ6
Sequence
Graphical view for this peptide sequence: actde-CXE5
Colored MSA for Plant_carboxylesterase (raw)
MNSSEVTHDFPPFFRVYKDGRIERYVAIGYVPPVVDPQTGVESKDVTISQ
ETDLKARIFIPKINSSDPKIPLVVHYHGGAFCIGSPFDALSHSFLTSLAS
KARAIVVSVDYRLAPEHPLPIAYDDSWSALQWIAAHSTGQGPDPWLNQHV
DFGRVFLAGESAGANIAHHVAVRAGLAGPGYLQVHGLILVHPFFANNEPD
EIIRFLYPGSSWSDNDPRLSPLEDPDLDKLGCSQVIVFVAGKDWLKSRGV
GYCEILKNRGWEGTVELVESEGEDHCYPLVQSPSEKAVLLVQSLGFFHQS
RLMQCNYMESLHHAL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNSSEVTHDFPPFFRVYKDGRIERYVAIGYVPPVVDPQTGVESKDVTISQ
ETDLKARIFIPKINSSDPKIPLVVHYHGGAFCIGSPFDALSHSFLTSLAS
KARAIVVSVDYRLAPEHPLPIAYDDSWSALQWIAAHSTGQGPDPWLNQHV
DFGRVFLAGESAGANIAHHVAVRAGLAGPGYLQVHGLILVHPFFANNEPD
EIIRFLYPGSSWSDNDPRLSPLEDPDLDKLGCSQVIVFVAGKDWLKSRGV
GYCEILKNRGWEGTVELVESEGEDHCYPLVQSPSEKAVLLVQSLGFFHQS
RLMQCNYMESLHHAL


References
    Title: A manually annotated Actinidia chinensis var. chinensis (kiwifruit) genome highlights the challenges associated with draft genomes and gene prediction in plants
    Pilkington SM, Crowhurst R, Hilario E, Nardozza S, Fraser L, Peng Y, Gunaseelan K, Simpson R, Tahir J and Schaffer RJ <89 more author(s)>
    Ref: BMC Genomics, 19:257, 2018 : PubMed

            

    Title: The carboxylesterase gene family from Arabidopsis thaliana
    Marshall SD, Putterill JJ, Plummer KM, Newcomb RD
    Ref: Journal of Molecular Evolution, 57:487, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer